KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_385Help
Entry
BLBBGE_385        CDS       T00995                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate-L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00471  D-Glutamine and D-glutamate metabolism
bbl00550  Peptidoglycan biosynthesis
bbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BLBBGE_385 (murC)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BLBBGE_385 (murC)
Enzymes [BR:bbl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     BLBBGE_385 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:bbl01011]
 Precursor biosynthesis
  Amino acid ligase
   BLBBGE_385 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_C Mur_ligase_M Mur_ligase TMEM100
Motif
Other DBs
NCBI-ProteinID: ACY40394
UniProt: D0JB56
Position
complement(380961..382331)
Genome map
AA seq 456 aa AA seqDB search
MNLNQVDFFYFLGIGGMGMSSLARYFHFMGKTVCGHDRIRTSLTQQLEKEGISINYYDCI
EMLPKWVLSQKCLIVYTPAIQNHHKQWIYLRKYGKNIKKRSQVLSLITENQICIAIGGTH
GKTTTCTLLGHILYSAGISVTAFLGGISENYKSNIILNGTKIFLVEADEFDRSFLYLSPN
IACVTSFDQDHVDTYPKKETLKKAYIAFLNRIKKPYKKIFLCKEESFPLKNAIYYSVIKK
ESYYSNHLSIKGNEWYFDFHTPTETWKSLPLPIPGIHNLKNVTAALSISDYLKINQEKVR
KALFLFQGIKRRYSIHYLSKKKIYIDDYAHHPTEINALIHTVKECFPNKKILGIFQPHLF
SRTKFFEESFAKSLEHLDILILLDIYPARELPMKGINSNNLLEKIKMSSKNKEISTLSKV
LEKIKEKHFDIILTIGAGDIDTLIIPIKKWLYKRYG
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaaaccaagttgattttttttattttctaggaataggaggaatggggatgagt
tcccttgctagatattttcattttatgggaaaaacagtttgtggtcatgatagaattaga
actagtttgactcaacaattagaaaaagagggaatatccatcaattattatgattgtata
gaaatgttacctaaatgggtattgtctcaaaaatgtttgattgtgtatactccagcaatt
caaaatcatcataaacaatggatctatttaagaaaatatgggaaaaatattaaaaaacgt
tctcaagtattgtccttgattacagaaaatcaaatttgtatagccataggaggaacacat
ggaaaaacaacgacttgtaccttgctaggacatattttatatagtgcaggaatttctgta
acggcttttttaggaggaatatctgaaaattataaatctaatatcatattgaatggaacc
aaaatttttttggttgaagcagacgaatttgatcgttcttttttatatttatctcctaat
attgcatgtgtgacgtctttcgatcaggatcatgtggatacttatccaaaaaaagaaact
ttaaaaaaggcttatatagcttttttaaacagaatcaaaaaaccatataaaaaaattttt
ctttgtaaagaagagtcttttccattaaaaaacgctatatattattcagtgataaaaaaa
gaaagttattattcaaatcatctttctataaaaggaaatgaatggtattttgattttcat
actcctacagaaacatggaaatctttgcctttacctattccaggaatacacaatttaaaa
aacgtaacagcagcattgtctatatctgattatctaaaaattaatcaagaaaaagtaaga
aaagctttgtttttatttcaaggaatcaaaagaagatattccatacattatctatctaaa
aaaaaaatatatatagatgattatgcacatcatcctacagaaataaatgctttgattcat
actgttaaagagtgttttccaaataaaaaaatattgggtatttttcaacctcatttgttt
agtcgaactaaattttttgaagaatcttttgcaaaaagtttagaacatcttgacatttta
atattattagacatttatccagctagagaacttcccatgaaaggaattaattccaataat
ttattagaaaaaataaaaatgagttctaaaaataaagaaatatctactttatccaaagtt
ttagaaaaaatcaaagaaaaacattttgatattattctaacaataggtgctggggatata
gataccttaatcattcctataaaaaaatggttgtataaacgatatggataa

DBGET integrated database retrieval system