KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_404Help
Entry
BLBBGE_404        CDS       T00995                                 

Definition
(GenBank) transketolase C-terminal subunit
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00030  Pentose phosphate pathway
bbl01100  Metabolic pathways
bbl01110  Biosynthesis of secondary metabolites
bbl01120  Microbial metabolism in diverse environments
bbl01130  Biosynthesis of antibiotics
bbl01200  Carbon metabolism
bbl01230  Biosynthesis of amino acids
Module
bbl_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BLBBGE_404
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    BLBBGE_404
Enzymes [BR:bbl01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     BLBBGE_404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II Epimerase_2
Motif
Other DBs
NCBI-ProteinID: ACY40413
UniProt: D0JB75
Position
402368..403339
Genome map
AA seq 323 aa AA seqDB search
MNMKQYENKGLKETRAGFGQALTFLGKKNKRVVALCADLTSSLFMNQFSKEFPERFFQIG
IAEANMIGIAAGLSIGKYIPFAGTFANFATSRVYDQIRQSIAYSYKNVKICASHSGLTLG
EDGATHQSLEDIGMMKMLPGMTVINTCDYNQTYAATLAIAHYLGPVYLRFGRPAVANFTD
ENQMFEIGKAVLLTEGKDVTIVCTGHLVWEALEASKILYREEGIECEVINIHTIKPLDET
SILKSVNKTKCVLTAEEHNYWGGLGESVARILTTKKCYVPQSLVAVNDVFGESGKPMELL
KKYNIDCNSIINRIQILLKKKKN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgaaacaatatgaaaataaagggctcaaagaaactagagctgggtttggtcaa
gctttgacttttttgggaaaaaaaaataaaagagtggtagcattgtgtgccgatttgact
agctctttatttatgaatcaattttcaaaagaattcccagaaagattttttcaaatagga
atagcagaagctaatatgattggaatagcagctggactgagtattggaaaatatattccg
tttgcaggtacatttgctaattttgctacatctcgtgtctatgatcagatacgtcaatct
attgcttattcttataaaaacgtaaaaatatgtgcttctcattctggattaactctagga
gaagatggagctacacatcaaagtttagaggatattggaatgatgaaaatgttacctggg
atgactgttatcaatacatgtgactataatcaaacttatgcagctactttagcgatagct
cattatttaggcccagtttatttacgttttggtcgccctgctgtagctaattttacggat
gaaaatcaaatgtttgaaatcggaaaagctgttcttttaacagaaggaaaagatgttacc
attgtttgcacaggacatttggtatgggaagctttagaagcctctaaaattttgtacaga
gaagaaggaatagaatgtgaagtaattaacattcatacaatcaaaccgttggatgaaacg
tctattttaaaatctgtaaataagacgaaatgtgttctcactgcagaagaacacaattat
tggggaggattaggggaaagtgtagctaggatacttactaccaaaaaatgttatgttcct
caaagtttagtagctgttaatgatgtttttggagagagtggaaaacctatggaacttttg
aaaaaatataacattgattgtaattctattataaatcgtatacagattttgttgaaaaaa
aagaaaaattaa

DBGET integrated database retrieval system