KEGG   Blattabacterium sp. (Blattella germanica): BLBBGE_417Help
Entry
BLBBGE_417        CDS       T00995                                 

Definition
E1-E2 family cation transport ATPase (EC:3.6.3.-)
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
bbl  Blattabacterium sp. (Blattella germanica)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(413491..415722)
Genome map
AA seq 743 aa AA seqDB search
MKKHDFFDFLDDKKIAEKLIDFNHNNITTVRFLIPSIHCSSCVLVLETLSKFHKNILEST
VDFSSKQIWITFNNVEFKLSSLARLLDDMGYRPSINFESIEKRKINNTFDRKLIGKLAIS
FFCFANIMLLAIPGYVGAYQDAWFLENRNFFHYLMFILSLPVVIFSLKDHVKYAILGFKK
HVLNIDVPISIGILVLFLWSCYEIFFDLGSGYFDSISSFSLFLLVSRIFQIHTHNKILSF
DKNYKSFYPVLMTRIHEKNEKEEKILLSSLKKGDIILIRNEEIIPADSILIKGNAVLDNS
FITGESHLINKKIGDRVYAGSKQKGEAIFLKVIKNVDHSYLSLLWNKNQSNHHKKLFYLN
SISTQFSQYFTPAILIISIMSGIYWYLNNDISKIFQTTFSVLIITCPCALVLSTPLIFGN
IIRFFSKKSFYIKDIFTMERISAIKTLIFDKTGTITDPNKEKIFFIGNMKYEEKKIVASL
LKNSIHPLSQRILSELSIKDFYSIKNFKEIMGKGLEGVIKNIPVKIGSKEYLGITKKIKD
RNQTTVFISINNKFVGYFLFRNYYRKGIKKIFQNLKEYKIIILSGDKNELEKNYLKSILP
KTGKVLFNQSPENKLNYVKKLQKKGEKIMMFGDGINDCAALSRSEVGVAVSENPTSFFPN
CDAFLQSDCLNKIFLFLKISKISSKLVIVNFMISLFYNIIGIYFAVTGNLKPFIAAILMP
LSSFSVVFFSIISTWIVSRRFIF
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacatgatttttttgattttcttgatgataaaaaaattgcagaaaaattaatt
gatttcaatcataataatattacaactgttcgctttttaatcccttctattcattgtagt
tcttgtgttcttgttttagagactttatcgaagtttcataaaaatattctagaatctact
gttgacttttccagtaaacaaatttggataacatttaataatgtagaattcaaactaagt
agtttagctagactccttgatgacatggggtatagaccttctattaattttgaatcaata
gaaaaaagaaaaatcaataacacatttgacagaaaattaataggaaaattagctatttcc
tttttttgttttgcaaatattatgcttttggctattccaggatatgttggagcctatcaa
gatgcatggtttttagaaaatagaaacttttttcattatctcatgttcattttatcttta
ccagttgtaatattttctcttaaagatcatgtaaaatatgccattttaggattcaaaaaa
catgttttgaatatagatgttcctatttccataggaatattagttctttttttatggagc
tgttacgaaattttttttgatttaggttctggctatttcgatagcatttctagtttttct
ttatttctacttgtaagcagaatatttcaaattcatactcataataaaattctttctttt
gacaaaaattataaatctttttatcccgttttaatgacaagaatacatgagaaaaatgaa
aaagaagaaaaaattttgctttcttctttgaaaaaaggagatattattttaattaggaat
gaagaaattattcctgccgattctatacttataaaaggaaatgctgtattggataacagt
tttattactggcgaatctcatttaataaataaaaaaataggagatcgagtttatgctggt
tctaaacaaaaaggagaagctatttttttgaaagtcattaagaatgtagatcatagttat
ttgagtttattatggaataaaaaccaatctaatcatcataaaaaattattttatttaaat
tcaatatccactcaattcagtcaatattttactcctgctattttgatcatttctataatg
agtggaatttattggtacttaaacaacgatatttcaaaaatatttcagaccactttttct
gttttaattatcacttgtccttgtgccttggtactttctactccattgatatttggaaat
atcatacgatttttctctaaaaaaagtttttatataaaagatatttttacaatggaaaga
atctctgcaataaaaactttaatttttgataagacaggaactataacggatccaaataaa
gaaaaaatattttttataggaaacatgaaatatgaggaaaaaaaaattgtagcatcttta
ttaaaaaactctattcatcctctaagtcaaagaatattatcagaattatctatcaaagat
ttttattctataaagaattttaaagaaataatgggaaaaggattagaaggagtcataaaa
aatataccggttaaaattggatctaaagaatatttaggaattacaaaaaaaataaaagat
agaaatcaaacaacagtttttatttctataaataataagtttgtaggttattttttattt
agaaattattatcggaaaggtataaaaaaaatatttcaaaatttgaaagagtataaaata
attattctttctggagataaaaatgaattagaaaaaaattacttgaaatctattttacct
aagactggtaaagtcctttttaatcagagtccagaaaataaactaaattatgttaaaaaa
ttacaaaaaaagggagaaaaaatcatgatgtttggagatggcattaatgattgtgcagct
ttaagtagaagtgaagtaggggttgctgtatctgaaaatccaactagtttttttccaaat
tgtgatgcatttttgcaatctgattgtttgaataaaattttcttatttttaaagatatcc
aaaatatctagcaaactagtgattgtcaattttatgatcagtttattttataatattata
gggatttattttgctgtaaccgggaatttaaaaccttttatagcagctattctaatgcct
ttaagttccttttctgttgtttttttttccataatatctacttggatcgtttcacgacga
tttatattttag

DBGET integrated database retrieval system