KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_425Help
Entry
BLBBGE_425        CDS       T00995                                 

Gene name
trpFB
Definition
bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta (EC:4.2.1.20 5.3.1.24)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
K01817  
phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLBBGE_425 (trpFB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLBBGE_425 (trpFB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLBBGE_425 (trpFB)
Enzymes [BR:bbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLBBGE_425 (trpFB)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     BLBBGE_425 (trpFB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
422669..424501
Genome map
AA seq 610 aa AA seqDB search
MIMKCKSLKIKICGMKFNIQEISDFLPDFMGFIFYPNSPRFVGIDFLIPKLKKKVFKTGV
FVNESEKNVLKISQKNQLDFIQLHGTESPFYCEKLFKKRLKLIKAFRIDDFFSFKNVVDY
IPFCTYFLFDNNTINYGGSGKKFCWEKLDEYNFKIPFFLSGGIGIKDFDKIKNFSHSKIF
GIDINSRFEIFPGKKDDIALNTFIKKNKRIMKYFVDKNGYYGEFGGAFIPEMLHHNITEL
QDQYKKFITSFEFQKLYKKILKNYAGRPTPLFFCKKYSDKYKAKIYLKREDLNHTGSHKI
NNSIGQALLAKQLGKKKIIAETGAGQHGVATATTCALMNLECIIFMGETDIHRQYTNVLR
MKSLGAKVIPVCSGDKTLKDAVNEAIRYWISHPESYYLIGSTVGPHPYPQMVADIQSIIS
EEIKIQLKEKEGSSFPNYVVACIGGGSNAAGSFYHFLDNDSVNLVAVEAAGLGVNTKKTA
ASIHCGSRGILHGSMTMLLQNEDGQVLPAHSISAGLDYPGIGPMFANLFVKKRVNFLHST
DEEALQAGYELTRLEGIIPALESSHALAALKNIPFKKMDVVVVTLSGRGDKDINVYDKFF
TKFSGDEQNT
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgattatgaaatgcaaatcattaaaaataaaaatatgtggaatgaaattcaatatacaa
gaaatttcagattttttacctgattttatgggttttatattttatcctaattctcccaga
tttgtggggattgattttttgattccaaaattaaaaaaaaaagtattcaaaactggagtt
tttgtaaatgaatcagaaaaaaatgtattgaaaatcagtcaaaagaatcaattggatttt
attcaattgcatggaacagaaagtcctttttattgtgaaaaattattcaaaaaaagatta
aaattaattaaagcttttagaatagatgattttttttcttttaaaaacgttgtagattac
attcctttttgtacttattttctatttgataataatacaatcaactatggagggagcgga
aaaaaattttgttgggaaaaacttgatgaatataattttaaaattccattttttttaagt
ggaggaattggaataaaagattttgataaaattaaaaatttttcacattcaaaaatattt
ggaattgatataaacagtcgatttgaaatatttccaggaaaaaaagacgatatagcgtta
aatacctttataaaaaaaaataagagaattatgaaatattttgttgataaaaatgggtat
tatggagaatttggaggagcttttattcctgaaatgttgcatcataatataacagaatta
caagatcaatataaaaaattcattacaagttttgaatttcaaaaattgtataaaaaaata
ctaaaaaattatgcaggaagacctactcctttatttttttgcaaaaaatattctgataaa
tataaagctaaaatttatctaaaaagagaagatttgaatcacacaggatcgcataaaatt
aataattctataggacaagcattgttggcaaaacaattgggaaaaaaaaagattattgct
gaaactggagctggacaacatggagtcgctactgctactacttgtgcattaatgaattta
gaatgtattatttttatgggagaaacggatatacaccgtcaatatactaatgttcttaga
atgaaatctcttggggccaaagtgattcctgtttgtagtggagataaaacactgaaagat
gcggtaaatgaagctattcgttattggataagccatccagaaagttattatttaataggg
tctacagttggacctcatccttatcctcaaatggttgcagatattcaatctattattagt
gaagaaattaaaattcagttaaaagaaaaggaaggatcttcttttcctaattatgtagtt
gcttgcataggaggtggaagtaatgcagctggatctttttatcattttttggataacgat
tccgtgaatctagtagcagtagaagccgcaggattaggagtgaatacaaaaaaaacagca
gcatctattcactgtggatctagaggaatattacatggaagtatgactatgctattgcaa
aatgaagatggtcaagttcttcctgctcattctatatctgctggattagattatccggga
ataggccctatgtttgctaatctttttgtaaaaaaacgtgttaattttttgcattccaca
gatgaagaagctttgcaggcaggatatgaattgaccagattagaaggaatcattccagct
ttggaaagttctcatgcattagctgcactcaaaaacatcccatttaaaaaaatggatgtg
gtagttgtcactctatctggaagaggtgacaaagatatcaatgtttatgataaatttttt
acaaaattctcaggcgatgaacaaaatacatga

DBGET integrated database retrieval system