KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_426Help
Entry
BLBBGE_426        CDS       T00995                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00260  Glycine, serine and threonine metabolism
bbl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbl01100  Metabolic pathways
bbl01110  Biosynthesis of secondary metabolites
bbl01130  Biosynthesis of antibiotics
bbl01230  Biosynthesis of amino acids
Module
bbl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLBBGE_426 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLBBGE_426 (trpA)
Enzymes [BR:bbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLBBGE_426 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ACY40434
UniProt: D0JB96
Position
424485..425258
Genome map
AA seq 257 aa AA seqDB search
MNKIHDLFRNKSENILCIYFTAGYPNVNSTVKIIKILQNLPVDLIEIGIPYSDPLADGMI
IQKSNQTSLNNGMNVSLLFSQIKQFKKEIKIPILLMGYYNQFYKFGEEKFLKKCKESGIS
GLIIPDLPVDLFVKKYQNLFKKYLLSMIFLITTQTDSSRVFMLSQITDGFLYLVSSNSTT
GKVDNFFGKEQISFFERIKKLSINIPKLIGFGINNRETFDFSCQYANGGIIGSSFIQSLN
ENQLEESIKKYIKFIRE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaatacatgatttattcagaaataaaagtgaaaacatattatgcatttatttt
acagcgggatatcctaatgtaaacagcacagtaaaaataataaaaatattgcagaatctt
cctgttgacttaatagaaatagggattccttattctgatcctttggcagatggaatgatt
attcaaaaaagcaatcaaacctctctgaataacggaatgaatgtttctttattattttct
caaatcaaacaatttaaaaaagaaatcaaaattcctattcttcttatgggatattacaat
caattttataagtttggagaagaaaaatttttgaaaaaatgtaaggaatcaggaatttct
ggattaattattccagatcttcctgttgatttgttcgttaaaaaatatcaaaatttgttt
aaaaagtatttattatcaatgatatttttgatcactacacaaacggattcatctagagtt
ttcatgttaagtcaaataactgatggttttttatacttggtttcttctaattcaacaaca
ggaaaagttgataatttttttgggaaagaacaaatatctttttttgaacgtataaaaaaa
ctgtctataaacattcctaaattgattggttttggaatcaataacagagaaacttttgat
ttttcatgtcaatatgcaaatggaggaattattggaagttcttttattcaatcattaaat
gaaaatcaattagaagaaagcataaaaaaatatataaaatttattagagaatag

DBGET integrated database retrieval system