KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_426Help
Entry
BLBBGE_426        CDS       T00995                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLBBGE_426 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLBBGE_426 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLBBGE_426 (trpA)
Enzymes [BR:bbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLBBGE_426 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
424485..425258
Genome map
AA seq 257 aa AA seqDB search
MNKIHDLFRNKSENILCIYFTAGYPNVNSTVKIIKILQNLPVDLIEIGIPYSDPLADGMI
IQKSNQTSLNNGMNVSLLFSQIKQFKKEIKIPILLMGYYNQFYKFGEEKFLKKCKESGIS
GLIIPDLPVDLFVKKYQNLFKKYLLSMIFLITTQTDSSRVFMLSQITDGFLYLVSSNSTT
GKVDNFFGKEQISFFERIKKLSINIPKLIGFGINNRETFDFSCQYANGGIIGSSFIQSLN
ENQLEESIKKYIKFIRE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaatacatgatttattcagaaataaaagtgaaaacatattatgcatttatttt
acagcgggatatcctaatgtaaacagcacagtaaaaataataaaaatattgcagaatctt
cctgttgacttaatagaaatagggattccttattctgatcctttggcagatggaatgatt
attcaaaaaagcaatcaaacctctctgaataacggaatgaatgtttctttattattttct
caaatcaaacaatttaaaaaagaaatcaaaattcctattcttcttatgggatattacaat
caattttataagtttggagaagaaaaatttttgaaaaaatgtaaggaatcaggaatttct
ggattaattattccagatcttcctgttgatttgttcgttaaaaaatatcaaaatttgttt
aaaaagtatttattatcaatgatatttttgatcactacacaaacggattcatctagagtt
ttcatgttaagtcaaataactgatggttttttatacttggtttcttctaattcaacaaca
ggaaaagttgataatttttttgggaaagaacaaatatctttttttgaacgtataaaaaaa
ctgtctataaacattcctaaattgattggttttggaatcaataacagagaaacttttgat
ttttcatgtcaatatgcaaatggaggaattattggaagttcttttattcaatcattaaat
gaaaatcaattagaagaaagcataaaaaaatatataaaatttattagagaatag

DBGET integrated database retrieval system