KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_499Help
Entry
BLBBGE_499        CDS       T00995                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLBBGE_499 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLBBGE_499 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BLBBGE_499 (thrC)
Enzymes [BR:bbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BLBBGE_499 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(502078..503394)
Genome map
AA seq 438 aa AA seqDB search
MLYHSLKNHKNLVSFEDAVLRGLAPDGGLYIPVSIPVLDPKLIHNLSSYDIYTISMTVIK
PYIGKSIPEEFIYNIIHDTLNFPFPLQKIHDNIHVLELFHGPTLAFKDVGAKFMAECLSF
FSKKIGKDVTVLVATSGDTGGAVAKGFHKKSGIEVIILYPYNGISSLQKEQITSLGNNVL
AIEIDGNFDDCQKMVKKAFLDEEIQKKYILTSANSINVARWLPQMFYYFLAYRQIIEDPI
ELIFSVPSGNFGNICAGIMAEKMGLPIKFFIASTNVNDTIPRFLKTEKYHPLPVKKTISN
AMDISDPSNFSRIWHLYKKNMSQLRKKFFSYQFTDEETLDIIEMVWKEHKYMLDPHGAIG
YLGLRQYLQTVKKTSASTAIFLETAHPIKFIDDMPYFLREKIIVPKGLETFLSEKRKKQK
MSLSNDFNLFKDWLLERK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgttgtatcatagtttaaaaaatcataaaaatttagtttcttttgaagatgctgtttta
agaggtttagcgccagatggtggattatacattcctgtatctattcctgtattagatcct
aaattaattcataacctttctagttatgatatttatacaatttctatgactgttatcaaa
ccttatataggaaaatctatcccagaagaatttatctataatattattcatgatacttta
aattttccttttccattgcaaaaaattcatgataatattcacgtattagagctttttcat
ggtccaactttagcttttaaagatgtaggcgctaaatttatggcagaatgtttgagtttt
ttttcaaaaaaaataggaaaagatgtaacagttttagtcgctacttcaggagatactggt
ggagctgttgctaaagggtttcataaaaaatctggaatagaagtaatcattttatatcca
tataatggaattagttccttacaaaaggaacaaattacttctttgggaaacaatgtatta
gctatagaaattgatgggaattttgatgattgtcaaaaaatggtaaaaaaagccttttta
gatgaggaaatacaaaaaaaatatatattaacttctgcgaattctattaatgtagctaga
tggcttcctcaaatgttctattattttttagcttatagacaaatcatagaggatccgata
gaattaattttttcagttcctagtggaaattttggaaatatttgtgccggaataatggct
gaaaaaatgggccttcccatcaagttttttattgcctccacaaatgtaaatgataccatt
cctaggtttttgaaaactgaaaaatatcatccacttccagtaaaaaaaacgatatcaaat
gctatggatatatctgatcccagcaacttttctagaatatggcatttgtacaaaaaaaat
atgtctcaattaagaaaaaaatttttttcctatcaatttacggacgaagaaactctagac
attatagagatggtatggaaagaacacaaatatatgctggatccacacggagctattggt
tatttaggacttagacaatatttacagacagtaaaaaaaacttcagcttctacagctatt
tttttagaaacggctcatccaattaaatttatagatgatatgccgtattttttaagagaa
aaaattattgttcctaagggactagaaacatttttaagtgaaaaaagaaaaaaacaaaaa
atgtccttatccaatgattttaatctttttaaagattggttattagaaagaaaataa

DBGET integrated database retrieval system