KEGG   Blattabacterium sp. (Blattella germanica): BLBBGE_499Help
Entry
BLBBGE_499        CDS       T00995                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bbl  Blattabacterium sp. (Blattella germanica)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbl01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bbl00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:bbl00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(502078..503394)
Genome map
AA seq 438 aa AA seqDB search
MLYHSLKNHKNLVSFEDAVLRGLAPDGGLYIPVSIPVLDPKLIHNLSSYDIYTISMTVIK
PYIGKSIPEEFIYNIIHDTLNFPFPLQKIHDNIHVLELFHGPTLAFKDVGAKFMAECLSF
FSKKIGKDVTVLVATSGDTGGAVAKGFHKKSGIEVIILYPYNGISSLQKEQITSLGNNVL
AIEIDGNFDDCQKMVKKAFLDEEIQKKYILTSANSINVARWLPQMFYYFLAYRQIIEDPI
ELIFSVPSGNFGNICAGIMAEKMGLPIKFFIASTNVNDTIPRFLKTEKYHPLPVKKTISN
AMDISDPSNFSRIWHLYKKNMSQLRKKFFSYQFTDEETLDIIEMVWKEHKYMLDPHGAIG
YLGLRQYLQTVKKTSASTAIFLETAHPIKFIDDMPYFLREKIIVPKGLETFLSEKRKKQK
MSLSNDFNLFKDWLLERK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgttgtatcatagtttaaaaaatcataaaaatttagtttcttttgaagatgctgtttta
agaggtttagcgccagatggtggattatacattcctgtatctattcctgtattagatcct
aaattaattcataacctttctagttatgatatttatacaatttctatgactgttatcaaa
ccttatataggaaaatctatcccagaagaatttatctataatattattcatgatacttta
aattttccttttccattgcaaaaaattcatgataatattcacgtattagagctttttcat
ggtccaactttagcttttaaagatgtaggcgctaaatttatggcagaatgtttgagtttt
ttttcaaaaaaaataggaaaagatgtaacagttttagtcgctacttcaggagatactggt
ggagctgttgctaaagggtttcataaaaaatctggaatagaagtaatcattttatatcca
tataatggaattagttccttacaaaaggaacaaattacttctttgggaaacaatgtatta
gctatagaaattgatgggaattttgatgattgtcaaaaaatggtaaaaaaagccttttta
gatgaggaaatacaaaaaaaatatatattaacttctgcgaattctattaatgtagctaga
tggcttcctcaaatgttctattattttttagcttatagacaaatcatagaggatccgata
gaattaattttttcagttcctagtggaaattttggaaatatttgtgccggaataatggct
gaaaaaatgggccttcccatcaagttttttattgcctccacaaatgtaaatgataccatt
cctaggtttttgaaaactgaaaaatatcatccacttccagtaaaaaaaacgatatcaaat
gctatggatatatctgatcccagcaacttttctagaatatggcatttgtacaaaaaaaat
atgtctcaattaagaaaaaaatttttttcctatcaatttacggacgaagaaactctagac
attatagagatggtatggaaagaacacaaatatatgctggatccacacggagctattggt
tatttaggacttagacaatatttacagacagtaaaaaaaacttcagcttctacagctatt
tttttagaaacggctcatccaattaaatttatagatgatatgccgtattttttaagagaa
aaaattattgttcctaagggactagaaacatttttaagtgaaaaaagaaaaaaacaaaaa
atgtccttatccaatgattttaatctttttaaagattggttattagaaagaaaataa

DBGET integrated database retrieval system