KEGG   Blattabacterium sp. (Blattella germanica): BLBBGE_570Help
Entry
BLBBGE_570        CDS       T00995                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bbl  Blattabacterium sp. (Blattella germanica)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bbl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(568170..568856)
Genome map
AA seq 228 aa AA seqDB search
MMKEKQKKILKNTDQNYILNNNNLVNSKSISQKNNFLMNDEEKIEKIEEHFFQIMETLGL
DMNDDSLRRTPKRVAKMFIQEIFSGLNPKNTPTLSIFDNKYKYNQMLIEKNITVYSTCEH
HFLPIVGKAHVGYISNGKVIGLSKINRIVNFYAKRPQVQERLTMQIVESLQKMLKTQDVA
CVIKAKHLCVNSRGIRDIDSSTVTTELVGSFKKNSEIRREFLHHIGIS
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagaaaaacagaaaaaaattttaaaaaacactgatcaaaattatattttgaat
aataataatttagtcaatagtaaaagtatttcacaaaaaaataattttttgatgaatgat
gaagaaaaaattgaaaaaatagaagaacattttttccagattatggaaacattaggttta
gatatgaatgatgatagtttacgtcgcactcccaaacgtgtggctaaaatgtttattcaa
gaaatatttagtggtcttaaccctaaaaatactccgaccctttctatttttgataataaa
tataaatacaatcaaatgttgatagaaaaaaatataacagtttactcgacttgtgaacat
cattttcttcctattgtcggaaaagctcatgttggttatatttctaatggaaaggttatt
ggactttctaaaattaatagaattgtgaatttttatgcaaaaagaccacaagttcaagaa
cgtttgactatgcaaattgtcgaatctttacaaaaaatgttaaaaacacaagatgttgct
tgtgtaataaaagcaaaacacttatgtgtcaattctcgtggaattcgagatatagatagt
agtacagtaacaacggaattagtaggatctttcaaaaaaaattcagaaattagaagagaa
tttcttcatcacattggaatttcttaa

DBGET integrated database retrieval system