KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_576Help
Entry
BLBBGE_576        CDS       T00995                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00860  Porphyrin and chlorophyll metabolism
bbl01100  Metabolic pathways
bbl01110  Biosynthesis of secondary metabolites
bbl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BLBBGE_576 (hemD)
Enzymes [BR:bbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BLBBGE_576 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACY40576
UniProt: D0JBN8
Position
573818..574492
Genome map
AA seq 224 aa AA seqDB search
MINILMTKSVDFSIFSKKYFFIQSYDFLSIKYSKLYKRPILNNQLIFTSYNGVKGFLYNF
EYCFFRKKIYVVGEKTFFFLKKHFPYCFFFQKDYVQDIIEEIIKTKSNQYYDWFCGNKNI
FNQDINFFKEKNINRYEVYKTFLIPRKIKNLSDYHGIIFFSPSGVQSFFLNNKIENNTKT
EIFAIGKTTAKFISNFLHKKIWIPKKPSLKEVFTLVKNFYDVYI
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgattaatattcttatgacgaaatctgtggatttttctattttttcaaaaaaatatttt
tttattcaatcttatgattttctatcaataaaatattcgaaattgtataaaagacctatt
ttaaataatcagttaatatttactagttataacggagttaaaggttttttatacaatttc
gaatattgtttttttcgaaaaaagatatatgtggtaggagaaaaaacatttttttttctc
aagaaacactttccttattgttttttttttcaaaaagattatgttcaagatataatagaa
gaaattataaaaacaaaatctaatcaatactacgattggttttgtggaaataaaaatatt
tttaatcaagatattaattttttcaaagaaaagaatatcaatcgatatgaagtttataaa
acatttttaattcctagaaaaataaaaaatttatccgattaccatggaatcatttttttt
agtccttctggggtacaatctttttttttgaataataaaatagaaaataatacaaaaacc
gaaatttttgctataggaaaaaccacagctaaattcatttcaaattttttgcataaaaaa
atatggattcctaaaaaaccttctttaaaagaagtttttactcttgtaaaaaatttttat
gatgtttacatataa

DBGET integrated database retrieval system