KEGG   Bordetella bronchiseptica MO149: BN115_0093Help
Entry
BN115_0093        CDS       T02295                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN115_0093 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN115_0093 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BN115_0093 (glcB)
Enzymes [BR:bbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BN115_0093 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(91434..93611)
Genome map
AA seq 725 aa AA seqDB search
MTERIPHHGLQVAASLHRFIEDEALSGSGLAPDEFWAGFAALVRDLAPRNRELLAERDRL
QGEIDAWHRAHPGPVRDSAGYQALLERIGYLQPQPAQVTASTRDVDSEIASQAGPQLVVP
VSNARYALNAANARWGSLYDALYGTDAIPPVAGDDGKGYNPARGEAVIARARAFLDEAAP
LAQGSHADATAYAIEGGKLAVTLGAGQRTGLRNPAQLAGYQGDASQPAAVLLANNGLHFE
IQIDRQHQIGATDAAGVKDVLLEAALTTIMDCEDSVAAVDADDKVLIYRNWLGLMKGDLS
ESVTKGGKTFTRRLNADRQYHKPDGGTLTLHGRSLMFVRNVGHLMTNPAILDEQGSEVPE
GILDAVITSLAALPDRANRLNSRTGSIYIVKPKMHGPAEAAFANELFDRVEDLLKLPRHT
IKMGIMDEERRTSVNLKACIAAAAARVAFINTGFLDRTGDEMHTGMEAGPMLRKGDMKSS
AWITAYERNNVLVGLDCGLRGRAQIGKGMWAMPDLMAAMLEQKIGHPKAGANTAWVPSPT
AATLHAMHYHQVDVAAVQQALEQTRYDSVRDELLAGLLTVPVGDPAAWSADDIQRELDNN
AQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLRHGIVDRAQVNAT
FERMAKVVDQQNAGDPNYLPMAGHFDTSFAYRAACALVFEGLTQPNGYTEPLLHEYRQAF
KATRR
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacgcatcccgcatcatggcctgcaagtggcggcctccctgcaccgtttcatc
gaagacgaggcgctgtccggcagcggcctggcgcccgacgagttctgggctggcttcgcc
gccctggtgcgcgacctcgcgccgcgcaaccgcgaactgctggccgagcgcgaccgcctg
cagggcgaaatcgacgcctggcaccgcgcccatcccggccccgtgcgcgacagcgccgga
tatcaggcgctgctcgaacgcatcggctacctgcagccccagccggcacaggtaaccgcc
agtacccgcgacgtggacagcgagatcgccagccaggccggcccgcagctggtggttccc
gtctccaacgcgcgctatgcgctgaacgcggccaacgcccgctggggcagcctgtacgac
gcgctctatggcaccgacgcgatcccgccggtggccggcgatgacggcaagggctacaac
ccggcgcgcggcgaagccgtgatcgcccgcgcgcgcgccttcctggacgaggcggcgccg
ctggcccagggttcgcacgccgacgccaccgcctacgccatcgagggtggcaagctggcg
gtcacgctgggcgccggccagcgcacgggcctgcgcaaccccgcgcaactggccggctat
cagggcgacgcctcgcaaccggccgccgtgctgctggccaacaacggcctgcacttcgaa
atccagatcgaccgccagcaccagatcggcgccaccgatgccgccggcgtcaaggacgtg
ctgctcgaggccgccctgaccaccatcatggattgcgaagactccgtggcggccgtcgat
gccgacgacaaggtactgatctaccgcaactggctcgggctcatgaagggcgacctgagc
gaatcggtcaccaagggcggcaagaccttcacccgccgcctgaacgccgaccgccagtac
cacaagcccgacggcggcaccctgacgctgcacggccgctcgttgatgttcgtgcgcaac
gtcggccacctgatgaccaacccggccatcctcgacgagcagggcagtgaagtgccggaa
ggcatcctggatgcggtgatcaccagcctggccgccctgcccgaccgcgccaaccggctc
aactcgcgcaccggctcgatctacatcgtcaagcccaagatgcacgggccggccgaggcc
gccttcgccaacgagttgttcgaccgcgtcgaggacctgctcaagctgccgcgccacacc
atcaagatgggcatcatggacgaagagcggcgcaccagcgtcaacctgaaggcctgcatc
gcggccgcggcggcgcgcgtggctttcatcaacaccgggttcctggaccgcaccggcgac
gaaatgcataccggcatggaagccggcccgatgctgcgcaagggcgatatgaaatccagc
gcctggatcaccgcctacgagcgcaacaacgtgctggtcgggctggactgcggcctgcgc
gggcgcgcccagatcggcaagggcatgtgggccatgcccgacctgatggcggccatgctc
gaacagaagatcggccaccccaaggcgggcgccaacacggcctgggtgccctcgcccacg
gccgcgaccctgcacgccatgcactatcaccaggtcgacgtcgcggccgtgcagcaggcg
ctggagcaaacccgctacgacagcgtgcgcgacgaactgctggccggcctgctgaccgtt
ccggtaggcgatccggccgcctggtcggccgatgacatccagcgcgagctcgacaacaac
gcccagggcatcctgggctacgtggtgcgctggatcgaccagggcgtgggatgctcgaag
gtgcccgacatcaacaacgtcggcctgatggaagaccgcgccaccctgcgcatctccagc
cagcacatcgccaactggctgcgccacggcatcgtcgaccgcgcacaggtcaacgccacg
ttcgaacgcatggccaaggtcgtcgaccagcaaaacgccggcgatcccaactacctgccc
atggccggccacttcgacacctcgttcgcctaccgcgcggcgtgcgcgttggtattcgag
ggcctgacccagcccaacggctacaccgagcccctgctgcacgagtaccggcaagccttc
aaggcgacccggcgctga

DBGET integrated database retrieval system