KEGG   Bordetella bronchiseptica MO149: BN115_0587Help
Entry
BN115_0587        CDS       T02295                                 

Definition
(GenBank) putative thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN115_0587
   00630 Glyoxylate and dicarboxylate metabolism
    BN115_0587
   00640 Propanoate metabolism
    BN115_0587
   00650 Butanoate metabolism
    BN115_0587
  Lipid metabolism
   00071 Fatty acid degradation
    BN115_0587
   00072 Synthesis and degradation of ketone bodies
    BN115_0587
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN115_0587
   00310 Lysine degradation
    BN115_0587
   00380 Tryptophan metabolism
    BN115_0587
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN115_0587
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN115_0587
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN115_0587
Enzymes [BR:bbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN115_0587
Exosome [BR:bbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN115_0587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
629421..630626
Genome map
AA seq 401 aa AA seqDB search
MRRAAIVSPLRTPVGAFGGALKAVPVEELGATVARAIVQRTGLDPARIDDVVFAQSYASG
ETPCTGRWVALQAGFPIEVAGMQLDRRCGGGVQAVATAAMMVQTGAADVVMAGGVESMSN
VEHYTTDMRWGKRAGSVTLHDRLDRGRERSQPESRFGRISGMIETAETLAREYGISREQA
DLFAARSHQRAAAAQAAGHFDAEIVPISVAQRKGEPLLVGQDEGVRGETSAESLGRLRTI
MKEGVVTAGNACQQNDAAAACLIVAEDKLEELGLEPMGWLVGWAAAGCDPARMGIGPVPA
VSKVLARTGLAFDQMDLIELNEAFACQALACVKGWGSSMDALQDRLNVNGSGISLGHPVG
ATGVRIMTTLLHEMQRRKARYGLETMCIGGGQGIAMIVERA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagacgagcagccatagtttctccgctgcgcacgcccgtgggggcattcggcggggca
ttgaaggcggttcccgtggaagagctgggcgccaccgtggcgcgcgccatcgtgcagcgt
acgggcctggacccggcacgcatcgacgacgtggtgttcgcccagagctacgccagcggc
gagacgccttgcaccgggcgctgggtggccctgcaggcgggatttccgatcgaagtggcc
ggcatgcagctggaccgccgctgcggcggcggcgtgcaggccgtggccacggcggccatg
atggtgcagaccggcgcggccgacgtggtcatggccggcggcgtcgagagcatgagcaac
gtcgagcactacacgaccgatatgcgctggggcaagcgcgccggctcggtcacgctgcac
gaccggctggaccgggggcgcgagcgctcgcagcccgagagccgctttggccgcatcagc
ggcatgatcgagacggccgagacgctggcgcgcgagtacggcatcagccgcgagcaggcc
gacctcttcgccgcgcgcagccaccagcgggcggccgcggcgcaggcggcgggccacttc
gatgcggagatcgttcccatctcggttgcgcaacgcaagggcgagcccctgctggtcggc
caggacgaaggcgtgcgcggcgagaccagcgccgaaagcctgggcaggctgcgcaccatc
atgaaagagggcgtggtcaccgccggcaatgcctgccagcagaacgacgccgcggcggcg
tgcctgatcgtcgccgaggacaagctggaggagctcggcctcgagccgatgggctggctg
gtcggctgggccgcggccggctgcgacccggcgcgcatgggcatcggcccggtgccggcc
gtgagcaaggtgctggcgcgcaccggcctggccttcgaccagatggacctgatcgagctg
aacgaggcgtttgcctgccaggcgctggcctgcgtcaagggctggggaagttccatggac
gcgctgcaggacaggctcaacgtcaacggctcgggcatttcgctgggccaccccgtcggc
gcgacgggcgtgcgcatcatgaccacgctgttgcacgaaatgcagcggcgcaaggcccgc
tacggcctggagaccatgtgcataggcggtggccagggcatagccatgattgtcgagcgc
gcctga

DBGET integrated database retrieval system