KEGG   Bordetella bronchiseptica MO149: BN115_0603Help
Entry
BN115_0603        CDS       T02295                                 

Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
bbm00071  Fatty acid degradation
bbm00280  Valine, leucine and isoleucine degradation
bbm00281  Geraniol degradation
bbm00310  Lysine degradation
bbm00360  Phenylalanine metabolism
bbm00362  Benzoate degradation
bbm00380  Tryptophan metabolism
bbm00410  beta-Alanine metabolism
bbm00627  Aminobenzoate degradation
bbm00640  Propanoate metabolism
bbm00650  Butanoate metabolism
bbm00903  Limonene and pinene degradation
bbm00930  Caprolactam degradation
bbm01100  Metabolic pathways
bbm01110  Biosynthesis of secondary metabolites
bbm01120  Microbial metabolism in diverse environments
bbm01130  Biosynthesis of antibiotics
bbm01212  Fatty acid metabolism
Module
bbm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN115_0603
   00650 Butanoate metabolism
    BN115_0603
  Lipid metabolism
   00071 Fatty acid degradation
    BN115_0603
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN115_0603
   00310 Lysine degradation
    BN115_0603
   00360 Phenylalanine metabolism
    BN115_0603
   00380 Tryptophan metabolism
    BN115_0603
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN115_0603
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN115_0603
   00281 Geraniol degradation
    BN115_0603
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN115_0603
   00627 Aminobenzoate degradation
    BN115_0603
   00930 Caprolactam degradation
    BN115_0603
Enzymes [BR:bbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN115_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CCJ57359
Position
complement(648368..649225)
Genome map
AA seq 285 aa AA seqDB search
MRRGAMNTHQRYGAVSNMRYEDFEFLLCEPQDDGVMLVTLNRPDAMNATNDRMHWELTRI
WGVVNDDPGVKAVVVTGAGERAFSAGGDLSVVEAMSNSHETTMRVMKEASDIVYNMLACD
KPIISAINGTAVGAGLAVALLADVSVMAEDAKLTDGHARLGVSAGDHAAIIWPILCGMSK
AKYYLMTADFVDGKEAERIGLVTFCAPRAEVLPRSLAIAAKLARGSQTAIRATKKSLNNW
MRTAGPAFDNSLALEMLCFLGPDVKEGLAALRDKRAPDFPSARLP
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgtggcgcaatgaatacgcatcaacgctatggagccgtatcgaacatgcgctac
gaagactttgaattcctgctgtgcgaaccccaggacgacggcgtcatgctggtcacgctc
aaccggcccgacgccatgaacgccaccaacgaccgcatgcactgggaactgacccggatc
tggggcgtcgtcaacgacgaccccggcgtcaaggcggtcgtggtcaccggcgccggcgaa
cgggcgttctcggcgggcggcgacctgtccgtcgtggaggccatgtccaacagccacgaa
accaccatgcgggtcatgaaagaggcctccgacatcgtctacaacatgctggcctgcgac
aagccgatcatttccgcgatcaacggcacggccgtgggcgccggcctggccgtggccctg
ctggccgatgtgagcgtcatggccgaggatgcgaagctgaccgacgggcacgcccggctg
ggcgtctcggccggagaccatgccgccatcatctggccgattctctgcggcatgtccaag
gcgaagtactacctgatgaccgcggacttcgtcgacggcaaggaagccgaacgcatcggg
ctggtgacgttctgcgcgccgcgcgccgaggtcctgcccaggtcgctcgcgattgccgcg
aagctggcgcggggcagccagacagccatccgcgcgaccaagaagtcgctcaacaactgg
atgcgcaccgccggccccgccttcgacaattcgctggcgctggaaatgctgtgcttcctg
ggcccggacgtcaaggaaggattggccgcgctgcgcgacaagcgcgcgcccgatttcccc
tcggcgcgcctgccctga

DBGET integrated database retrieval system