KEGG   Bordetella bronchiseptica MO149: BN115_0647Help
Entry
BN115_0647        CDS       T02295                                 

Gene name
gst
Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BN115_0647 (gst)
Enzymes [BR:bbm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BN115_0647 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
693368..694006
Genome map
AA seq 212 aa AA seqDB search
MKFYHEVRGCSLAVDIVARELGLALDLQWVDMANKRLADGSDYLKVNSKGTVPTLELPDG
QFLSEGAVIMQYLADQRPQQGMLPAAGTLARYRVLEWMSFIAADLHKGGFMPLFKAITPP
EYRRIARQYLDGRLQWLNDQLAGREFLMGETFTIADAHCYTIAMWTRAHDIDTSAWPHLE
AYLARVGARPSVRAAEQAARDEGERQRAAAAQ
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctatcacgaggtgcgcggctgctcgctggccgtcgatatcgtcgcgcgcgag
ctggggctggcgctggacctgcagtgggtcgacatggccaataagcggctggccgacggg
tccgattacctgaaggtcaattcgaagggcacggtgccgacgctggagctgcccgatggg
cagttcctcagcgaaggcgcggtgatcatgcagtacctggcggaccagcgaccgcagcaa
ggcatgctgccggccgccggcacgctggcgcgctaccgggtgctggagtggatgagcttc
atcgccgccgacctgcacaagggcggcttcatgccgctgttcaaggcgatcacgccgccc
gagtaccggcgcatcgcccgccagtacctggacggccgcctgcagtggctgaacgatcag
ctggctggccgcgaattcctcatgggcgagacgttcaccatcgccgacgcgcattgctac
acgatcgccatgtggacccgcgcgcacgacatcgacacgagcgcatggccgcacctggaa
gcctacctggcgcgcgtgggcgcccggcccagcgtgcgcgccgccgagcaggccgcgcgc
gacgaaggcgagcgccagcgcgcggccgccgcccaataa

DBGET integrated database retrieval system