KEGG   Bordetella bronchiseptica MO149: BN115_0996Help
Entry
BN115_0996        CDS       T02295                                 

Gene name
pepM
Definition
phosphoenolpyruvate phosphomutase
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Metabolism of other amino acids; Phosphonate and phosphinate metabolism [PATH:bbm00440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1081584..1082456
Genome map
AA seq 290 aa AA seqDB search
MTKNRSLRAALESGQLFTAMAAHNPLAARLAEEAGFGGIWGSGFELSASYAVPDANILSM
GTHLEMMRAIAATVSIPLIADIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPKDTSL
RAEGRQELVRIEEFQGKVAAAAAARKDPDFVVIARVEALIAGQGQDEAIRRGLAYEEAGA
DAILIHSKQKTPDEILAFIAAWPGRKPLVLVPTAYPQLGERDIAALGKVGVVIYGNHAIR
AAVGAMREVFAQIRRDQGIGQADRGLPTVKEIIALQGDAHMREIEARYLK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaagaatcgatccctacgcgccgcgctcgaaagcggccagctcttcacggccatg
gccgcgcacaatcccctggcggccaggctggccgaggaggccggattcggcggcatctgg
ggcagcggcttcgagctgtcggccagctacgccgtgccggacgccaacattctttccatg
ggcacgcacctggaaatgatgcgcgccatcgccgcgaccgtgtcgatcccgctgatcgcc
gacatcgataccggcttcggcaatgcggtcaacgtgcattacgtggtgccgcagtacgag
gccgcgggcgcttcggccatcgtcatggaggacaagacctttcccaaggacaccagcctg
cgcgccgagggccgccaggaactggtgcgcatcgaggagttccagggcaaggtcgccgcc
gccgcggccgcgcgcaaggaccccgacttcgtcgtgatcgcgcgggtcgaggcgctgatc
gcggggcagggccaggacgaggccatccggcgcggcctggcctacgaggaagccggcgcg
gacgccattctcatccattccaagcagaagacgcccgacgagatcctggccttcatcgcc
gcgtggccgggccgcaagcccctggtgctggtgcccaccgcgtacccgcagctgggcgag
cgggatatcgccgcgctgggcaaggtgggcgtggtcatctacggcaaccacgccatccgc
gccgccgtgggcgccatgcgcgaggtcttcgcgcagatccgccgcgaccagggcatcggc
caggccgatcgcggcctgcccacggtcaaggagatcatcgccctgcagggcgatgcgcac
atgcgcgagatcgaggcccgctacctgaagtag

DBGET integrated database retrieval system