KEGG   Bordetella bronchiseptica MO149: BN115_1378Help
Entry
BN115_1378        CDS       T02295                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BN115_1378
Enzymes [BR:bbm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BN115_1378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1477142..1478047
Genome map
AA seq 301 aa AA seqDB search
MGVPARRPAGEAALACVLGIPFDCGTHPFRVGARQGPDAIREQSRLLRPYDLARRAGVDN
PVEFLRLLDLGNVACVPGDPQASYPAIEQAVAQVLQAGAIPITMGGDGAVTLPQLRAVAR
RWPGVAVLHFDSHTDTYPIAGYNTATTFTRAAEEGLIDLSHSFHVGTRGNSFMGGVIEYG
REVGYTVIPYDDFDRDQAGTLARLRGQLGDRPVYLCFDMDIFDPSCAPGVCTPEWGGLSP
KEGLNLLRALSGLNFVAFDVNTVSPPQDVGGATAFLAASVMQEFCALAAAAVQAYPQGRP
D
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgccggcgcggcgccccgccggagaggccgcgttggcctgtgtgctgggcatt
ccgttcgactgcggcacgcatccgttccgggtgggcgcgcggcaggggccggacgcgata
cgcgagcaatcgcgcctgctgcgcccgtacgacctggcgcgccgcgccggggtggacaac
ccggtggagttcctgcgcctgctggacctgggcaacgtggcctgcgtgccgggcgatccg
caggcttcctatccggccatcgagcaggccgtcgcgcaggtgctgcaagccggcgccatt
cccatcaccatgggcggcgacggcgcggtcacgctgccgcagctgcgcgcggtggcgcgc
cgctggccgggcgtggccgtgctgcatttcgattcgcacaccgacacctatcccatcgcc
ggctacaacaccgccaccaccttcacgcgcgccgccgaggaagggctgatcgatctctcg
cacagttttcacgtgggcacgcgcggcaattcgttcatgggcggcgtcatcgagtacggc
cgcgaagtcggctacacggtgatcccgtacgacgacttcgaccgcgaccaggccggcacg
ctggcgcgcctgcgcggccaattgggcgaccggccggtctacctgtgcttcgacatggat
atcttcgatccctcctgcgcgccgggcgtgtgcacgccggagtggggcggcctctcgccc
aaggagggcctgaacctgctgcgggccctgagcggcctgaacttcgtcgccttcgacgtc
aataccgtatcgccgccgcaggacgtgggcggcgcgacggcgttcctggcggcctccgtg
atgcaagaattctgcgccctggccgccgcggcggtacaggcctatccgcaagggcggccg
gactga

DBGET integrated database retrieval system