KEGG   Bordetella bronchiseptica MO149: BN115_1508Help
Entry
BN115_1508        CDS       T02295                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bbm00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bbm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1625116..1626417
Genome map
AA seq 433 aa AA seqDB search
MSNLIVHGGKPLRGRITPSANKNAVLPVLCATLLTSEPLRLHRVPDITDVRKILDIFRML
GSEVRMDHATDTLELHHRATRFDAATHRLPEEMRSSIMLVPPLLARFGVARLEDNVKGCT
LGVREIDPHVDVFCRFGGAVTRAEGSLLVRSAGDLVPNDHWLDYASVTTTENFVLCAAAA
PGVSTLTNAASEPHVQEFCRFMTLMGVRIEGIGTSRLTVHGGGALGGGEFTFDEDFHEIT
TFLALGAITGGDVAVRNSAPGNFPLIDRTFAKFGVRITHEDGWSRASTPGSLQVQTPFTS
NVLTKVEAAPWPYFPVDLLPIFIALGVRARGNAMFWNKVYDGAMGWTGELSKFGAHVFLS
DPHRLITFGGSPLTPASVESPYIIRVAIALFMVAASIEGRSEIRNATPIRRAHPRFVENL
RSLGVEVEWESEE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatctcatcgtgcacggcggcaagccgctgcgtggccgtatcacgccttccgcc
aacaagaacgccgtcctgcccgtgctgtgcgcgacgctgctgaccagcgaaccgctgcgc
ctgcatcgggtgcccgacatcaccgatgtgcgcaagatcctggatatcttccgcatgctg
ggcagcgaagtgcgcatggaccatgccaccgacacgctggagctgcatcaccgcgccacg
cgctttgacgccgccacccaccggctgccggaggaaatgcgctcgtccatcatgctggtg
ccgccgctgctggcgcgcttcggcgtggcgcggctggaggacaacgtcaagggctgcacg
ctgggcgtgcgcgagatcgacccgcacgtggatgtgttctgccgtttcggcggcgcggtg
actcgcgccgaaggctcgctgctggtgcgcagcgccggcgacctggttcccaacgaccac
tggctcgattatgcgtcggtcaccaccacggagaatttcgtgctgtgcgcggcggcggcg
ccgggcgtttcgacgctgaccaatgcggcctcggagccgcacgtgcaggagttctgccgc
ttcatgacgctgatgggcgtgcgcatcgagggcatcggcacgtcgcgcctgaccgtgcac
ggcggcggcgccctgggcggcggcgagttcaccttcgacgaagacttccacgaaatcacg
accttcctggcgctgggcgccatcaccggcggcgacgtggcggtgcgcaacagcgcgccg
ggcaacttcccgctgatcgaccgcaccttcgccaagttcggcgtgcgcatcacgcacgag
gacggctggtcgcgcgccagcacgccgggcagcctgcaggtgcagacgccgttcaccagc
aatgtgctgaccaaggtcgaagcggcgccgtggccgtattttccggtggacctgctgccg
attttcatcgcgctgggcgtgcgggcgcgcggcaacgccatgttctggaacaaggtatac
gacggggccatgggctggacgggcgaactgtccaagttcggcgcgcacgtgttcctgtcc
gacccgcaccgcctcatcaccttcggcggcagcccgctgacgccggccagcgtcgaaagc
ccgtacatcatccgcgtggcgatcgcgctgttcatggtggcggccagcatcgaaggccgc
tcggaaatccgcaacgccacgcccatccgccgcgcccacccgcgcttcgtcgaaaacctg
cgcagcctgggcgtggaagtggagtgggagagcgaagagtaa

DBGET integrated database retrieval system