KEGG   Bordetella bronchiseptica MO149: BN115_1696Help
Entry
BN115_1696        CDS       T02295                                 

Definition
(GenBank) Putative enoyl-CoA hydratasee
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
bbm00071  Fatty acid degradation
bbm00280  Valine, leucine and isoleucine degradation
bbm00281  Geraniol degradation
bbm00310  Lysine degradation
bbm00362  Benzoate degradation
bbm00380  Tryptophan metabolism
bbm00410  beta-Alanine metabolism
bbm00640  Propanoate metabolism
bbm00650  Butanoate metabolism
bbm00903  Limonene and pinene degradation
bbm00930  Caprolactam degradation
bbm01040  Biosynthesis of unsaturated fatty acids
bbm01100  Metabolic pathways
bbm01110  Biosynthesis of secondary metabolites
bbm01120  Microbial metabolism in diverse environments
bbm01130  Biosynthesis of antibiotics
bbm01200  Carbon metabolism
bbm01212  Fatty acid metabolism
Module
bbm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN115_1696
   00650 Butanoate metabolism
    BN115_1696
  Lipid metabolism
   00071 Fatty acid degradation
    BN115_1696
   01040 Biosynthesis of unsaturated fatty acids
    BN115_1696
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN115_1696
   00310 Lysine degradation
    BN115_1696
   00380 Tryptophan metabolism
    BN115_1696
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN115_1696
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN115_1696
   00281 Geraniol degradation
    BN115_1696
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN115_1696
   00930 Caprolactam degradation
    BN115_1696
Enzymes [BR:bbm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BN115_1696
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN115_1696
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BN115_1696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 AlaDh_PNT_C ApbA UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: CCJ58452
Position
complement(1822752..1824695)
Genome map
AA seq 647 aa AA seqDB search
MNTPDLAYTHWRLHREADGLAWLALARADAAANSLSAEVMAELAAVLDALQAQPPKGLVI
LSGKENGFIVGADINEFGALQTPQQARELVARGWQLFNRLAATPYPTLALIRGHCLGGGL
ELALACRYRIAADDADTALGLPEAMLGIFPGWGGMRRLPALIGAPAALDMMLTGRRVDAR
RAAALGLVDARVPPRLLQAAARATVLSGRAPRRARGLPAWLNRWPLKALAARRARQGVAA
KDPQGHYPAPRAIIDIWARHGGNALHAPDLIDGILASDTARQLLRVFRLQERLKGYGKAA
VDAPVRRVHVVGAGVMGGDIAAWCAYRGLTVTLQDQDMARIAPALARAGAFFARKLKDRR
AARAAFDRLVPDPQGDGVAQADLVIEAISENAQAKQALYRQLEPRLKPGALLATNTSSLS
LAGLAQVLDQPQRLVGIHFFNPVARMPLVEVVLAADGDPRALARACAFVGRIGKLPLPVR
DAPGFLVNAVLAPYMLEAMRCVDEGMAPAAIDAAMAAFGMPMGPLELADTVGLDIAAAAG
AQLTGEQAPPRCLAERLARKELGRKSGRGFYAWRDGKAVKPAARGVPPGLVNRLLQPLID
SARERVAAGVVADADLADAGAIFGTGFAPYTGGPLQYASQREAVQRP
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcccgacctggcctacacccactggcgcctgcaccgtgaagccgacggcctg
gcatggctggcgctggcgcgcgccgacgccgccgcgaactcgctgtcggccgaggtcatg
gccgaactcgccgcggtgctcgacgccctgcaggcccagccgcccaaggggctggtcatt
ctctcgggcaaggagaacggcttcatcgtcggcgccgacatcaacgaattcggcgcgctg
cagacgccgcagcaggcgcgcgaactggtcgcgcgcggctggcagctgttcaaccggctg
gcggcgacgccgtaccccacgctggcgctgatacgcggccactgcctgggcggcggcctg
gaactggcgctggcctgccgctaccgcatcgccgccgacgacgccgacaccgcgctgggg
ctgccggaagccatgctgggcattttccccggctggggcggcatgcggcgcctgccggcg
ctgatcggcgcgccggccgcgctggacatgatgctgaccggacgccgggtcgacgcgcgc
cgcgccgcggcgctgggcctggtcgacgcgcgcgtgccgccgcggctgctgcaggccgcc
gcccgcgccaccgtgctgtcgggccgagcgccgcgccgcgcgcgcggcctgccggcctgg
ctgaaccgctggccgctcaaggcgctggcggcgcgccgcgcgcgccagggcgtggccgcc
aaggatccgcagggccactaccccgccccgcgcgccatcatcgacatctgggcccgccac
ggcggcaacgccctgcatgcgcccgacctgatagacggcatcctcgcttcggacacggcg
cgccagctgctgcgcgtgttccgcctgcaggagcggctcaagggctacggcaaggccgcg
gtcgacgcgcccgtgcggcgcgtgcacgtggtgggcgccggcgtcatgggcggcgatatc
gccgcctggtgcgcctaccgcgggttgaccgtcacgctgcaggaccaggacatggcgcgc
atcgcgccggcgctggcgcgcgccggcgccttcttcgcccgcaagctgaaggaccggcgc
gccgcgcgcgccgccttcgaccgcctggttcccgacccccagggcgatggcgtggcgcaa
gccgacctggtcatcgaggccatcagcgagaacgcccaggccaagcaggccctctaccgc
cagctcgaaccgcgcctgaaaccgggcgccctgctggccaccaatacctccagcctgtcg
ctggccgggctggcccaggtcctcgaccagccgcagcggctggtcggcatccatttcttc
aacccggtggcgcgcatgccgctggtcgaagtcgtgctcgccgccgacggcgatccgcgc
gcgctggcgcgggcctgcgccttcgtcggccgcatcggcaagctgccgctgcccgtgcgc
gacgcgccgggtttcctggtcaatgcggtgctggcgccctacatgctggaagcgatgcgc
tgcgtcgacgagggcatggcgccggcggccatcgacgccgccatggccgccttcggcatg
ccgatggggccgctcgagctggccgacaccgtcgggctggacatcgcggcggccgccggc
gcccagctcaccggcgagcaagcgccgccgcgctgcctggccgaacgcctggcgcgcaag
gaactgggccgcaagagcggccgcggcttttatgcctggcgcgacggcaaggcggtcaag
ccggccgcgcgcggcgtgccgccagggctggtcaaccgcctgctccagcccctgatcgac
agcgcccgcgagcgcgtggccgccggcgtcgtggccgatgcggacctggccgacgcgggc
gcgattttcggcacgggctttgccccctacacgggcggcccgctgcaatacgcaagtcaa
cgagaagccgtccagcggccttag

DBGET integrated database retrieval system