KEGG   Bordetella bronchiseptica MO149: BN115_1741Help
Entry
BN115_1741        CDS       T02295                                 

Definition
(GenBank) putative cytochrome c
  KO
K08738  cytochrome c
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
bbm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN115_1741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: CCJ58497
Position
1877240..1877650
Genome map
AA seq 136 aa AA seqDB search
MNAGLAWRAGALCLALAAPSAARAAAPDPVRGEQVYARCLACHALAYDRVGPRHCGLLGR
KAGSVPGFAYTQAMKDSGLTWDAATLDRFLADPLKTVPGTAMTYAGVPDAGERADLIAYL
RAAAASPACAGVATPH
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgggcctggcctggcgggccggcgcgctgtgcctggccctggccgcgccgtcg
gccgcgcgggccgcggcgcccgacccggtgcgcggcgagcaggtctacgcgcgctgcctg
gcctgccacgcgctggcctacgaccgggtggggccgcgccactgcggcctgctcgggcgc
aaggccggcagcgtgcccggtttcgcctatacgcaagccatgaaggactccggcctgacc
tgggacgccgccacgctcgaccgcttcctggccgatcccttgaagaccgtgccaggcacc
gccatgacctacgcgggcgtgccggatgcgggcgagcgcgccgacctcatcgcctacttg
cgcgcggccgccgcctcgccggcgtgcgcgggcgtggccacgccgcattag

DBGET integrated database retrieval system