KEGG   Bordetella bronchiseptica MO149: BN115_1741Help
Entry
BN115_1741        CDS       T02295                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BN115_1741
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN115_1741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1877240..1877650
Genome map
AA seq 136 aa AA seqDB search
MNAGLAWRAGALCLALAAPSAARAAAPDPVRGEQVYARCLACHALAYDRVGPRHCGLLGR
KAGSVPGFAYTQAMKDSGLTWDAATLDRFLADPLKTVPGTAMTYAGVPDAGERADLIAYL
RAAAASPACAGVATPH
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgggcctggcctggcgggccggcgcgctgtgcctggccctggccgcgccgtcg
gccgcgcgggccgcggcgcccgacccggtgcgcggcgagcaggtctacgcgcgctgcctg
gcctgccacgcgctggcctacgaccgggtggggccgcgccactgcggcctgctcgggcgc
aaggccggcagcgtgcccggtttcgcctatacgcaagccatgaaggactccggcctgacc
tgggacgccgccacgctcgaccgcttcctggccgatcccttgaagaccgtgccaggcacc
gccatgacctacgcgggcgtgccggatgcgggcgagcgcgccgacctcatcgcctacttg
cgcgcggccgccgcctcgccggcgtgcgcgggcgtggccacgccgcattag

DBGET integrated database retrieval system