KEGG   Bordetella bronchiseptica MO149: BN115_1790Help
Entry
BN115_1790        CDS       T02295                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN115_1790
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN115_1790
Enzymes [BR:bbm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     BN115_1790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1937724..1938860
Genome map
AA seq 378 aa AA seqDB search
MFEARLTDVRANKLAQAWRLAYEQADGKRRRAMLGGLAQVGAGMQGDGAQGTRLFKRFNA
LPDGLRFLVALRADMLRWRKQVAGLQALDKELEALLSAWFDVGLLELRPLTWDSPASLLE
KLILYEAVHEIRSWDDLRHRVAGDRRCYAYFHPQMPDVPLIFVEVAFSAQMADNVQALLD
TSAPPQDLDKARWAIFYSISNTQPGLRGISFGNFLLKRVIDRLLQELPKLKFFATLSPIP
GFADWLSRLDAQEVEQAVRDKARARSGAPDGARWVARLARAATGKPSEVVQRAGLRLAAR
YLQAMRAGQPLDPVARFHLGNGARIERLNWAADTSAKGLAQSCGMMVNYLYELGDLDGNL
ARLNEGKPQVSRGIARLG
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgaggcgcgcctgaccgatgtgcgcgcgaacaagctggcgcaggcctggcgcctg
gcctacgagcaggccgacggcaagcggcgccgcgccatgctgggcgggctggcgcaggtc
ggcgccggcatgcagggcgacggcgcgcagggcacgcgcctgttcaagcggttcaatgcc
ttgcccgacggactgcgtttcctggtggcgctgcgcgccgacatgctgcgctggcgcaag
caggtcgccggactgcaggccctggacaaggagctggaggcgctgctgtcggcctggttc
gacgtgggcctgctggagctgcgcccgctgacctgggactcgcccgcctcgctgctcgag
aagctgatcctctacgaggccgtgcacgaaatccgctcgtgggacgatctgcgccaccgg
gtggcgggcgaccgccgctgctacgcgtattttcatccgcagatgccggacgtgccgctg
atcttcgtggaggtggcgttttcggcccagatggccgacaacgtccaggcgctgctcgac
accagcgcgccgccgcaggacctggacaaggcgcgctgggcgatcttctattccatctcg
aatacgcagcccggcctgcgcgggatcagcttcggcaacttcctgctcaagcgcgtgatc
gaccgcctgctgcaggagctgcccaagctgaaattcttcgccacgctgtcgcccattccc
ggcttcgccgactggctgtcgcggctggacgcgcaggaggtcgagcaggcggtgcgcgac
aaggcgcgcgcgcgcagcggcgctccggatggcgcgcgctgggtggcgcggctggcgcgc
gcggccacgggcaagccgtcggaagtggtgcagcgagccggcctgcgcctggccgcgcgc
tacctgcaggcgatgcgggccggccagccgctcgacccggtggcccgtttccacctgggc
aacggcgcgcgcatcgagcgcctgaactgggctgccgacacctcggccaagggcctggcg
cagtcctgcggcatgatggtgaactacctctacgagctgggcgacctggatggcaacctg
gcccgcctgaacgaaggcaagccgcaagtcagccgcggcatcgcgcgcctgggatga

DBGET integrated database retrieval system