KEGG   Bordetella bronchiseptica MO149: BN115_2281Help
Entry
BN115_2281        CDS       T02295                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN115_2281 (glgB)
Enzymes [BR:bbm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BN115_2281 (glgB)
Exosome [BR:bbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN115_2281 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2494250..2496445)
Genome map
AA seq 731 aa AA seqDB search
MMRDSPSIQGTLDAATQHALLAGRHADPFSVLGPHQAGAHTVVRVLAPGARTVMAVLPGG
QRTPLLPMQPGLFENTVPGLQPGAPTAYRLCIEWEAGIQHTADPYAFGPVLDAAQLDHCA
AGGWRYLADLLGAHAASVDGCAGTRFALWAPNARRVAVVGDFNGWDGRRHAMRLRYPAGV
WELFLPDVGPGARYKFQVLGADGHTVLKADPLARQAEAPPATASIVPDERPFAWTDEAWM
EQRAARQRCDAPISIYEVHAGSWFDDAGAPRWQSLAARLPEYARSLGFTHIELLPVMAHP
FGGSWGYQPLGLFAPAAAHGAPADFAHFVDRCHEAGLGVILDWVPAHFPDDAHGLARLDG
TPLYEHADPREGRHPDWNTLIYNYGRREVRAFLIASAIHWLRHYHVDGLRVDAVASMLYR
DYSRPAGQWIPNRHGGRENLEAIDFLRELNAAVGVQCPGAITVAEESTAWPGVTAPVANG
GLGFDYKWNMGWMHDTLRYMRRDPIHRRHHHHDLSFGMVYAYAERFVLPLSHDEVVHGKG
SLLGKMPGERAAQLAQLRLYYAFMWAHPGKKLLFMGGEFGQQGEWNHDAMLQWSLLDDPA
HRGLQRLVADLNHVYATLPELHCRDADPSGFAWIVGDDADNSVLAFARVDASHCLVAVCN
FTPVARPGYRFGVPHAGDWHVRVDTGATRYGGAGGGPPICLRSDPIPAHGHPQSLVLDLP
GFTALYLRHSE
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgggattcgccttccatccagggcacgctggacgcggccacccagcacgcgctg
ctggccggccgccatgccgatccgttttccgtgcttgggccgcaccaggccggcgcgcac
accgtggtgcgcgtgctggcgccgggcgcgcgcaccgtgatggccgtgctgcccggcggc
cagcgcacgcccttgctgcccatgcagcccggcctgttcgaaaacaccgtgccgggcctg
cagccgggcgcgccgacggcctaccgactgtgcatcgaatgggaggcgggcatccagcac
accgccgacccctacgcattcgggccggtgctcgacgccgcccagctcgaccattgcgcg
gccggcggctggcgctacctggccgacctgctgggcgcgcacgccgccagcgtggacggc
tgcgcgggcacccgcttcgcgctatgggcgcccaatgcccggcgcgtggcggtggtgggc
gatttcaacggctgggatggccggcgccacgccatgcgcctgcgctatccggccggcgtg
tgggagctgttcctgcccgacgtggggccgggcgcgcgctacaagttccaggtgctgggg
gccgacggccataccgtgctcaaggccgatccgctggcgcgccaggccgaggcgccgccc
gccaccgcgtccatcgtccccgacgaacgccccttcgcgtggaccgacgaggcctggatg
gaacaacgcgcggcgcgccagcgttgcgacgcgccgatctccatctacgaagtgcatgcc
ggctcctggttcgacgacgccggcgcgccgcgctggcaaagcctggccgcccgcctgccc
gagtacgcgcgctcgctgggcttcacccatatcgagctgctgccggtgatggcgcatccc
ttcggcggttcgtggggctaccagccgctcgggttgttcgcgccggcggccgcgcacggc
gcgccggccgacttcgcgcacttcgtcgaccgttgccacgaggccgggctgggcgtcatc
ctggactgggttccggcccacttccccgacgacgcgcacgggctggcgcgcctggacggc
acgccgctctacgagcacgccgacccgcgcgaaggccgccatcccgactggaacacgctg
atctacaactacggccgccgcgaggtgcgtgcctttctcatcgccagcgccatccactgg
ctgcgccattaccatgtcgacgggctgcgcgtggacgcggtcgcgtccatgctgtatcgc
gactacagccgcccggccggccagtggatccccaaccgccacggcgggcgcgagaatctc
gaagccatcgacttcctgcgcgaactcaacgccgccgtgggcgtccagtgccccggcgcc
atcaccgtggccgaggagtccaccgcctggcccggcgtgaccgcgccggtggccaacggg
gggctgggcttcgactacaagtggaacatgggctggatgcacgacacgctgcgctacatg
cggcgcgatccgatccatcgccgccatcaccaccacgatctcagcttcggcatggtctat
gcctatgccgagcgcttcgtgctgccgctctcgcatgacgaagtggtgcacggcaagggc
tcgctgctgggcaagatgccgggcgagcgggccgcccagctggcccagttgcggctgtac
tacgccttcatgtgggcccatcccggcaagaagctgctgttcatgggcggcgagttcggc
cagcaaggcgaatggaaccacgacgccatgctgcagtggtcgctgctggacgatccggcc
catcgcgggctgcagcgcctggtcgcggacctcaaccacgtctacgccaccctgcccgaa
ctgcattgccgcgacgccgacccgagcggcttcgcctggatcgtcggcgacgacgcggac
aacagcgtgctcgccttcgcccgcgtggacgccagccattgcctggtggccgtgtgcaac
ttcacgccggtggcgcggccgggctaccgcttcggcgtaccccacgcgggggattggcac
gtacgcgtggacaccggcgcgacgcgctacggcggcgccggcggcggcccgcccatctgc
ctgcgcagcgatcccatcccggcccatggacacccgcaatcgctggtcctggacctgccc
ggcttcaccgcgctgtacctgcgccactcggagtaa

DBGET integrated database retrieval system