KEGG   Bordetella bronchiseptica MO149: BN115_2416Help
Entry
BN115_2416        CDS       T02295                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BN115_2416
Enzymes [BR:bbm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BN115_2416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2634256..2635239
Genome map
AA seq 327 aa AA seqDB search
MPSPSALHDLCDTPPTFMGVPHRHAVDGARAAILGIPFDCGTHAFRIGARQGPQSIREQS
RLMRTFNPELADYNPLQRLGVIDCGNVRVVPSDILDAFERIEQAVGAIVDGGAVPVTMGG
DGSVSLPQLRAVGKRHPGLAVIHLDSHTDTNTFVKGKEYNAGTQFTHAALEGRVDTSLAF
HIGTRGTTFTQHVFRHARHFGYQIIPLNELLARGMAEVLQDLRARLGERPVYLCLDMDVL
DPSCAPGVCAPSWGGLSAREAIAFLRGLAGLNIVAIDVNTVSPPHDVNGTTASLAAALMV
EGLVLLCKRLGLDHPDPAPDFAAMYAR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgccatcccccagcgcgctgcatgacctgtgcgacacgccacctaccttcatgggcgtg
ccccatcgccatgccgtcgacggcgccagggcggccatcctgggcatccccttcgattgc
ggcacgcacgcgtttcgcatcggcgcgcgccagggtccgcagtcgatccgcgaacagtcg
cgcctgatgcgcaccttcaaccccgagctggccgactacaacccgctgcagcggctcggc
gtgatcgactgcggcaacgtgcgcgtggtgcccagcgacatcctcgacgccttcgagcgc
atcgagcaggcggtcggcgccatcgtcgatggcggcgcggtgccggtcaccatgggcggc
gacggcagcgtgtcgctgccccagctgcgcgcggtcggcaaacgccatccgggcctggcc
gtcatccacctcgactcgcacaccgacaccaataccttcgtcaagggcaaggaatacaac
gccggcacgcagttcacgcacgccgccctggaaggccgcgtggacacctcgctggcgttc
catatcggcacgcgcggcaccaccttcacccagcatgtgttccgccatgcgcgccacttc
ggctaccagatcatcccgctcaacgagctgctggcgcgcggcatggccgaagtgctgcag
gacctgcgcgcgcgcctgggcgaacggccggtctacctgtgcctggacatggacgtgctg
gatccgtcctgcgcgcccggggtgtgcgcgcccagctggggcggcctgagcgcgcgcgag
gcgatcgcgttcctgcgcggactggccggcctgaacatcgtcgccatcgacgtcaatacg
gtcagcccgccgcacgacgtcaatgggaccacggcatcgctggcggccgcgctgatggtc
gaaggcctggtgctgctgtgcaagcgcctgggactggaccatcccgacccggcgcccgac
ttcgccgccatgtacgcgcgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system