KEGG   Bordetella bronchiseptica MO149: BN115_2585Help
Entry
BN115_2585        CDS       T02295                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
bbm00010  Glycolysis / Gluconeogenesis
bbm00020  Citrate cycle (TCA cycle)
bbm00620  Pyruvate metabolism
bbm01100  Metabolic pathways
bbm01110  Biosynthesis of secondary metabolites
bbm01120  Microbial metabolism in diverse environments
bbm01130  Biosynthesis of antibiotics
bbm01200  Carbon metabolism
Module
bbm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN115_2585 (aceF)
   00020 Citrate cycle (TCA cycle)
    BN115_2585 (aceF)
   00620 Pyruvate metabolism
    BN115_2585 (aceF)
Enzymes [BR:bbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BN115_2585 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 HlyD_D23 RnfC_N HlyD_3 CAT
Motif
Other DBs
NCBI-ProteinID: CCJ59341
Position
complement(2806118..2807794)
Genome map
AA seq 558 aa AA seqDB search
MSNIVEIKVPDIGDFKEVEVIEVLVSAGDTIKAEQSLITVESDKASMEIPASAAGVVKSV
KVKVGDKIAEGTVILEVEAAGEAAAAPKAEAPKAEQAAETPKADAAKAEAPQAQAAQAEA
PAAAGPIEVKVPDIGDFKEVEVIEVLVAEGDTIKAEQSLITVESDKASMEIPASAGGVVQ
SLKVKVGDKVAMGTVIAVVQGQGAAAPAAKAEAPAAAPAAAEPAAPASPVAPASAPAQRP
APAAALQDEDLKPGQLPHASPSVRKFARELGVNLSRVTGSAAKGRITADDVRAYVKQALS
AGAPAGASGGGDGAALGLLPWPKIDFTKFGPIEAKPLSRIKKISGANLHRNWVMIPHVTN
NDEADITDLEALRVALNKENEKSGVKVTMLAFLIKAVVAALKKFPEFNASLDGDNLVLKQ
YYHIGFAADTPNGLVVPVVRDADKKGILELARETSELARKAREGKVSPAEMQGGCFSISS
LGGIGGTHFTPIINAPEVAILGVSRSAHKPVWDGKQFVPRLTLPLSLSYDHRVIDGASAA
RFNAYLGQLLADFRRIAL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatatcgtggaaatcaaggtaccggacatcggtgacttcaaggaggtggaagtc
atcgaggtgctggtatcggcgggcgacacgatcaaggccgagcaaagcctgatcacggtg
gagtccgacaaggcatcgatggagattccggcctcggccgcgggcgtggtgaagtcggtc
aaggtgaaggtgggcgacaagatcgccgaaggcacggtcatcctggaagtggaggcggcc
ggcgaggccgccgccgcgcccaaggccgaggcccccaaggccgagcaggccgccgagacg
cccaaggccgacgccgcgaaggccgaggcgcctcaggcgcaggcggcccaggccgaggcg
ccggccgccgccggcccgatcgaagtcaaggtgcccgatatcggcgacttcaaggaagtc
gaggtcatcgaggtgctggtcgccgagggcgacaccatcaaggccgagcaaagcctgatc
acggtcgagtccgacaaggcctcgatggaaatcccggcctcggcgggcggcgtggtgcag
tcgctcaaggtcaaggtaggcgacaaggtcgcgatgggcacggtcatcgccgtggtgcag
ggccagggcgctgccgcgccggcggccaaggccgaggcgcccgccgcggcgccggccgca
gccgagcccgccgcgccggcttcgcccgtggccccggcttcggctccggcgcagcggccc
gccccggccgccgcgctgcaggacgaagacctcaagcccggccaattgccgcatgcctcg
ccgtcggtgcgcaagttcgcgcgcgagctgggcgtgaacctgagccgcgtcaccggctcg
gccgcgaagggccgcatcacggccgatgacgtgcgcgcctacgtgaagcaggcgctgtcg
gccggcgcgccggctggcgcctcgggcggcggcgatggcgccgcgctggggctgctgccg
tggcccaagatcgatttcaccaagttcggccccatcgaagccaagccgctgtcgcgcatc
aagaagatctcgggcgccaacctgcaccgcaactgggtcatgatcccgcacgtcaccaac
aacgacgaagcggacatcaccgacctggaggcgctgcgcgtggcgctgaacaaggagaac
gagaaatcgggcgtcaaggtcaccatgctggccttcctgatcaaggcggtggtcgcggcg
ctgaagaagttccccgagttcaacgcctcgctggatggcgacaacctggtgctcaagcag
tactaccacatcggcttcgccgccgacacgcccaacgggctggtggtgccggtggtgcgc
gacgccgacaagaagggcatcctggagctggcccgcgaaacctccgagctggccaggaag
gcccgcgaaggcaaggtctcgcccgccgagatgcagggcggctgcttctcgatctcgtcg
ctgggcggcatcggcggcacgcatttcacgcccatcatcaacgcgcccgaagtggccatc
ctgggcgtgtcgcgctcggcccacaagccggtctgggacggcaagcagttcgtgccgcgc
ctgaccctgccgctgtcgctgtcctatgaccaccgcgtcatcgacggcgcctcggcggcg
cgcttcaacgcctatctcggccagctgctggccgacttccgccgcatcgcgctgtaa

DBGET integrated database retrieval system