KEGG   Bordetella bronchiseptica MO149: BN115_2687Help
Entry
BN115_2687        CDS       T02295                                 

Definition
(GenBank) probable glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bbm  Bordetella bronchiseptica MO149
Brite
Enzymes [BR:bbm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     BN115_2687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2914285..2914980)
Genome map
AA seq 231 aa AA seqDB search
MIDLYFWATPNGLKIKLFLEEAGLPYTEHPINIGKGEQFQREFLAIAPNNRIPAIVDQAP
AGGGAPISLFESGAILLYLAEKIGRFIPADVRGRAEVLQWLFWQMGGLGPMAGQNGHFNV
YAPEKVPYAIERYTAETARLYDVMDRRLAEREFLAGEYSIADIACYPWVVPHEAHGQKMA
HFPHLSRWFEAIAARPATARAYKEAGDSYRPKAPMSDEERTVLFGQPGAPR
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgattgatctgtatttctgggccacgcccaatggtttgaaaataaaactcttcctggaa
gaggccggcctgccctataccgagcacccgatcaacatcggcaagggcgagcagttccag
cgcgaattcctcgcgatcgcgcccaacaaccgcattcccgccatcgtcgaccaggcgccg
gctggcggcggcgcgccgatctcgctgttcgagtccggcgccatcctgctgtacctggcc
gagaagatcggccgcttcatccccgccgacgtgcgcggccgcgccgaagtcctgcagtgg
ctgttctggcagatgggcgggctggggcccatggccggccagaatgggcatttcaacgtc
tatgcccccgagaaggtgccgtacgccatcgaacgttacacggccgaaaccgcgcgcctg
tacgacgtgatggaccggcgcctggccgagcgcgagttcctggcgggcgagtactcgatc
gccgatatcgcctgctatccctgggtcgtgccgcacgaggcgcacggccagaagatggcc
catttcccgcacctgagccgctggttcgaggcgatcgccgcgcggcccgccacggcgcgc
gcctataaggaggccggcgacagctaccggcccaaggcgcccatgtcggacgaggaacga
accgtactgttcggccagccgggcgcgccgcgctag

DBGET integrated database retrieval system