KEGG   Bordetella bronchiseptica MO149: BN115_2950Help
Entry
BN115_2950        CDS       T02295                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN115_2950
Enzymes [BR:bbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BN115_2950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3199995..3200819)
Genome map
AA seq 274 aa AA seqDB search
MTGRSGPRGGLPMSQIAILTRPQGRNGALAQRLHDAGWQTLCLPALRIEPLPPENGVVPL
PRDYDLVVFVSGNAARLYLEQLGERGQLPWPAGAVAATVGPASARALLDSGQFGADTTVL
HPAETAPTHDSEALWALLRARPALPRRALLVRGTQGRDWLADRLAAAGVEVSRHAVYRRR
PAPWAQEGRQRLRDWALAGERPTWLLTSGEGIDALAQGLREEQLLDWWLQGRFVVTHPVL
AERLRALAGGGADAPMVKNCMPADEAIFATFVAA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
ttgacagggcggtcgggccctcgcgggggcttgcctatgtcgcagattgccatcctgaca
cggccgcaaggccgcaatggcgcgcttgcgcaacgcctgcacgacgccggttggcagacc
ctttgcctgccggccttgcgcatcgagccgttgccgcccgaaaacggcgtggtgccgctg
ccgcgcgactacgacctggtggtgtttgtcagcggcaacgcggcgcgcctgtacctggag
cagttgggagagcggggccaattgccatggccggcaggcgcggtcgccgccaccgtgggc
ccggccagcgcccgcgccctgctggattcgggccagtttggcgccgatacaacagttttg
caccccgcggaaaccgcgcccacccacgattcggaagccttgtgggccttgttgcgggcg
cgtccggcattgccgcgccgcgcgctgctggtgcgcggcacgcaggggcgcgactggctg
gccgatcgcctggctgcggctggcgtggaggtcagccgccacgccgtctaccgccggcgg
cccgcgccctgggcgcaggaggggcgccagcgcctgcgcgactgggccctggcgggcgag
cgcccgacctggctgctcaccagcggcgagggcatcgacgcgctggctcagggcctgcgc
gaggagcaattgctggactggtggctgcagggccgtttcgtcgtcacgcaccccgtgctg
gccgagcggctgcgggcgctggccggtggcggcgccgatgcgccaatggtaaaaaactgc
atgcctgccgatgaggcgatcttcgcgacttttgttgcggcttga

DBGET integrated database retrieval system