KEGG   Bordetella bronchiseptica MO149: BN115_2976Help
Entry
BN115_2976        CDS       T02295                                 

Gene name
pyrB
Definition
aspartate transcarbamoylase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BN115_2976 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN115_2976 (pyrB)
Enzymes [BR:bbm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BN115_2976 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3227724..3229061)
Genome map
AA seq 445 aa AA seqDB search
MRIAYIPYSSLGPPMSISQQAFLRDAMRRLNLTRDVFAGRIGVKRRALDTWLLPEGSQEF
RAMPEVVERFVSEIVQNRDLLEKYTQSGQVGPLRDRIAVEGRHQLLSVDQFTRESVEDLF
RVADMMQPIARRQKVSRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSS
MAKGESIYDTSRVMSGYVDAMVIRHPEQGSVAEFAEATNIPVVNGGDGPGEHPSQALLDL
YTILTEFSRLGKLLDGAHIAMVGDLKYGRTVHSLIKLLALYKGVKFTLISPQGLEMPGYI
VEQASRNGNVIEQKSTLAEGLAGADVIYATRVQKERFANEEAGEGYTADFQVSRAIIDAY
CGPDTIVMHPLPRDSRPGSNDLSTDLNHDPRLAIFRQTDNGIPIRMAIFAVLLGVEGLVQ
HSMRDVTWQHPSHIGPDDSVFHGLD
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattgcgtatattccgtattcctccctggggccgcccatgtccatttcccaacaa
gcctttctgcgcgacgccatgcgtcgtctcaacctgacgcgcgacgtgttcgccggccgc
atcggcgtgaagcgccgcgcgctggatacgtggctgctgcccgaagggtcgcaggagttt
cgcgcgatgcccgaagtggtggagcgcttcgtcagtgaaatcgtgcagaaccgcgacttg
ctggagaaatatacgcagagcgggcaggtaggccccttgcgcgaccgcattgccgtcgaa
gggcgccatcagctgctgtcggtcgatcaattcacccgcgaatcggtggaagacctgttc
cgcgtggcggatatgatgcaacccattgcgcgccgccagaaggtgtcgcgggtgctggaa
ggcgcggtgctgggcaacctgttcttcgaggccagcacgcgtactcgcgtcagcttcggc
gcggcgttctgccgcctgggcggctcggtctgcgacaccacgggcttcacgttctcgtcc
atggccaagggcgagtccatctacgataccagccgcgtgatgagcggctacgtcgacgcc
atggtcatccgccatcccgaacaggggtcggtggcggagttcgccgaggcgaccaatatt
ccggtggtcaatggcggcgatggcccgggcgaacatcccagccaggccctgctggacctg
tacaccatccttaccgagttctcgcgcctgggcaagctgctcgacggcgcgcacatcgcc
atggtcggcgacctgaagtacggccgcacggtgcactcgctgatcaagctgctggcgctg
tacaagggcgtgaagttcacgctgatttcgccgcagggcctggagatgcccggctacatc
gtcgagcaggccagccgcaacggcaatgtgatcgaacagaaaagcacgctggccgagggc
ctggcgggcgcggacgtcatttacgccacgcgcgtgcagaaagagcgcttcgccaacgaa
gaggcgggcgaaggctacacggcggacttccaggtcagccgcgccatcatcgacgcctac
tgcggtccggataccatcgtcatgcaccccttgccgcgcgacagccggccggggtccaac
gatctgagcacggatctgaaccacgacccgcgcctggcgattttccgccagaccgacaat
ggcattccgatccggatggcgatcttcgcggtgctgctgggcgtggaagggctggtgcag
cattcgatgcgcgacgtgacgtggcagcatccgtcgcacatcggccccgacgattccgtc
ttccacggcctggactga

  All links  
No link information was found.   
DBGET integrated database retrieval system