KEGG   Bordetella bronchiseptica MO149: BN115_3339Help
Entry
BN115_3339        CDS       T02295                                 

Gene name
odhB
Definition
(GenBank) 2-oxoglutarate dehydrogenase complex, E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
bbm00020  Citrate cycle (TCA cycle)
bbm00310  Lysine degradation
bbm01100  Metabolic pathways
bbm01110  Biosynthesis of secondary metabolites
bbm01120  Microbial metabolism in diverse environments
bbm01130  Biosynthesis of antibiotics
bbm01200  Carbon metabolism
Module
bbm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN115_3339 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BN115_3339 (odhB)
Enzymes [BR:bbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BN115_3339 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: CCJ60095
Position
complement(3645190..3646407)
Genome map
AA seq 405 aa AA seqDB search
MAITDVLVPQLSESVSEATLLTWKKQAGAAVEADEILIEIETDKVVLEVPAPSSGVLSEI
VMGDGSTVTSGEVIARIDTAAKAAAAPAAAAEAPAAAAAAPAAAAPAAASSAASGVASPA
AAKILAEKGVDAASVAGTGRDGRVTKGDALAAGNAPAAKAAAPVAPPTLSLDGRPEQRVP
MSRLRARIAERLLQSQAENAILTTFNEVNMQAVMDLRARYKDKFEKEHGVKLGFMSFFVK
AAVAALKKYPVLNASVDGKDIIYHGYFDIGIAVGTPRGLVVPILRNADQLTIAEIEKTIA
DFGKRAADGKLGIEEMTGGTFSISNGGVFGSMLSTPIINPPQAAILGIHATKERPVVENG
QIVIRPINYLAMSYDHRIIDGREAVLGLVAMKEALEDPQRLLLDL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggctattaccgacgttctcgtccctcaactgtccgaatcggtttcggaagccacgctg
ctgacctggaagaagcaggcgggcgccgcggtcgaggccgacgaaatcctgatcgaaatc
gagaccgacaaggtggtgctggaagtgccggccccgtcgtcgggcgtgctgtccgaaatc
gtcatgggtgacggcagcaccgtgacctcgggcgaggtcattgcccgcatcgacacggcc
gccaaggctgctgcggcgcctgccgccgctgccgaagcgcccgccgccgctgctgctgcg
ccggccgccgccgcgccggccgcggccagcagcgccgccagcggcgtggcctcgccggcc
gccgccaagatcctcgccgagaagggcgtggacgccgccagcgtggccggcaccggccgc
gacggccgcgtcaccaagggcgacgccctggccgcgggcaacgcgcccgccgccaaggcc
gccgcgccggtggcgccgcccacgctgtcgctggacggccgccccgagcagcgcgtgccc
atgagccgcctgcgcgcccgcatcgccgagcgcctgctgcaatcgcaagccgaaaacgcc
atcctgacgacgttcaacgaagtcaacatgcaggccgtgatggacctgcgcgcccgctac
aaggacaagttcgagaaagagcacggcgtcaagctgggcttcatgtcgttcttcgtcaag
gccgccgttgccgcgctgaagaagtacccggtgctcaacgcctcggtcgacggcaaggac
atcatctaccacggctacttcgacatcggcatcgccgtcggcaccccgcgtggcctggtg
gtgcccatcctgcgcaacgccgaccagctgaccattgccgaaatcgagaagaccatcgcc
gacttcggcaagcgcgccgcggacggcaagctgggcatcgaggaaatgaccggcggcacg
ttctcgatctccaacggcggggtgttcggctcgatgctgtccacgcccatcatcaacccg
ccgcaggcggccatcctgggcatccacgccaccaaggagcgcccggtggtcgagaacggc
cagatcgtcatccggccgatcaactacctggccatgtcctatgaccaccgcatcatcgac
ggccgcgaagccgtgctgggcctggtggccatgaaggaagcgctggaagacccgcaacgc
ctgttgctggatctgtaa

DBGET integrated database retrieval system