KEGG   Bordetella bronchiseptica MO149: BN115_3339Help
Entry
BN115_3339        CDS       T02295                                 

Gene name
odhB
Definition
2-oxoglutarate dehydrogenase complex, E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN115_3339 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN115_3339 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BN115_3339 (odhB)
Enzymes [BR:bbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BN115_3339 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3645190..3646407)
Genome map
AA seq 405 aa AA seqDB search
MAITDVLVPQLSESVSEATLLTWKKQAGAAVEADEILIEIETDKVVLEVPAPSSGVLSEI
VMGDGSTVTSGEVIARIDTAAKAAAAPAAAAEAPAAAAAAPAAAAPAAASSAASGVASPA
AAKILAEKGVDAASVAGTGRDGRVTKGDALAAGNAPAAKAAAPVAPPTLSLDGRPEQRVP
MSRLRARIAERLLQSQAENAILTTFNEVNMQAVMDLRARYKDKFEKEHGVKLGFMSFFVK
AAVAALKKYPVLNASVDGKDIIYHGYFDIGIAVGTPRGLVVPILRNADQLTIAEIEKTIA
DFGKRAADGKLGIEEMTGGTFSISNGGVFGSMLSTPIINPPQAAILGIHATKERPVVENG
QIVIRPINYLAMSYDHRIIDGREAVLGLVAMKEALEDPQRLLLDL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggctattaccgacgttctcgtccctcaactgtccgaatcggtttcggaagccacgctg
ctgacctggaagaagcaggcgggcgccgcggtcgaggccgacgaaatcctgatcgaaatc
gagaccgacaaggtggtgctggaagtgccggccccgtcgtcgggcgtgctgtccgaaatc
gtcatgggtgacggcagcaccgtgacctcgggcgaggtcattgcccgcatcgacacggcc
gccaaggctgctgcggcgcctgccgccgctgccgaagcgcccgccgccgctgctgctgcg
ccggccgccgccgcgccggccgcggccagcagcgccgccagcggcgtggcctcgccggcc
gccgccaagatcctcgccgagaagggcgtggacgccgccagcgtggccggcaccggccgc
gacggccgcgtcaccaagggcgacgccctggccgcgggcaacgcgcccgccgccaaggcc
gccgcgccggtggcgccgcccacgctgtcgctggacggccgccccgagcagcgcgtgccc
atgagccgcctgcgcgcccgcatcgccgagcgcctgctgcaatcgcaagccgaaaacgcc
atcctgacgacgttcaacgaagtcaacatgcaggccgtgatggacctgcgcgcccgctac
aaggacaagttcgagaaagagcacggcgtcaagctgggcttcatgtcgttcttcgtcaag
gccgccgttgccgcgctgaagaagtacccggtgctcaacgcctcggtcgacggcaaggac
atcatctaccacggctacttcgacatcggcatcgccgtcggcaccccgcgtggcctggtg
gtgcccatcctgcgcaacgccgaccagctgaccattgccgaaatcgagaagaccatcgcc
gacttcggcaagcgcgccgcggacggcaagctgggcatcgaggaaatgaccggcggcacg
ttctcgatctccaacggcggggtgttcggctcgatgctgtccacgcccatcatcaacccg
ccgcaggcggccatcctgggcatccacgccaccaaggagcgcccggtggtcgagaacggc
cagatcgtcatccggccgatcaactacctggccatgtcctatgaccaccgcatcatcgac
ggccgcgaagccgtgctgggcctggtggccatgaaggaagcgctggaagacccgcaacgc
ctgttgctggatctgtaa

DBGET integrated database retrieval system