KEGG   Bordetella bronchiseptica MO149: BN115_3409Help
Entry
BN115_3409        CDS       T02295                                 

Definition
hypothetical protein
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BN115_3409
   00240 Pyrimidine metabolism
    BN115_3409
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BN115_3409
   03430 Mismatch repair
    BN115_3409
   03440 Homologous recombination
    BN115_3409
Enzymes [BR:bbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BN115_3409
DNA replication proteins [BR:bbm03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BN115_3409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3726457..3726912
Genome map
AA seq 151 aa AA seqDB search
MTRIDFAFGAPDRLRAACRTARKRFQAGQRLVVYCADGGRLAAFDRMLWALEDVSFVPHV
LANDALAADTPVLLTAGDPAAALALATTGDSRPWLLNLDDGCPPNFDGYERLLEIVSDDP
ADRQAARQRWRDYQNAGHALHSHDLSRAGEA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcatcgacttcgccttcggcgctccggaccgcctgcgcgcggcctgccgcacc
gcgcgcaagcgcttccaggcgggccagcggctggtggtctactgcgccgacggcggacgc
ctggccgccttcgaccggatgctgtgggccctggaggacgtctcgttcgtgccgcatgtg
ctggccaacgacgcgctggcggccgacacgccggtcctgctgaccgcgggcgaccccgcc
gccgccctggcgctggccaccaccggcgacagccgcccctggctgctgaacctggatgac
ggctgcccgcccaacttcgatggctacgagcgcctgctggaaatcgtctccgacgacccg
gccgaccgccaggcggcgcgccagcgctggcgcgactatcagaatgccggccatgcgctg
cacagccatgacctgagccgcgcgggcgaggcctga

DBGET integrated database retrieval system