KEGG   Bordetella bronchiseptica MO149: BN115_3414Help
Entry
BN115_3414        CDS       T02295                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN115_3414
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN115_3414
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BN115_3414
Enzymes [BR:bbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BN115_3414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
3730194..3731294
Genome map
AA seq 366 aa AA seqDB search
MLMNPSLSRLRCLRCSHAVPPGDYPEGCPRCLAAGYPASLACEYEPADTQPMPLPVLAPI
TLGEGRTPCLDAPSLAHAHGVAQVWLKCESGNPTGSHKDRMAAQLVSRAVLAGAKRLAAA
SSGNAGVALAAYGAAAGLRVDIAIAPTCPPRQRAAMEHFGARLHSFADSLARWPYVATLC
RDEGAFAGTNYLNPPVGTHPYGVEGYKPIAAELAAQCDNLPTDIIVPTARGDLLWGICLG
WQALLRRGAIARLPRLHAVEPYPRLAHALAAGDARGVWEQPTAQYSIAGGTVTLQSMQAL
ARSGGQAVDVADEQAARARAALGALGIAAELSSAAALAAVPALKAAGALDAGSRVALILT
SDGRRD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgaacccctcgctgtcccgcctgcgctgcctgcgctgttcccacgccgtgccg
ccgggcgactatccggaaggctgcccgcgctgcctggcggccggctacccggcctcgctg
gcatgcgaatacgaaccggccgatacgcagccgatgccgctgccggtcctcgcgccgatc
acgctgggcgaaggccgcacgccctgcctcgacgcgccgtcgctggcgcatgcgcacggg
gtggcgcaagtctggctgaaatgcgaaagcggcaacccgacgggcagccacaaggaccgc
atggctgcgcaactggtgtcgcgcgcggtgctggccggcgccaagcggctggcggccgcg
tccagcggcaacgccggcgtggcgctggcggcctacggggccgccgccggcctgcgggtg
gacatcgccattgcgcccacctgcccgccgcggcaacgcgccgccatggaacacttcggc
gcgcgcctgcacagcttcgccgacagcctggcgcgctggccctacgtggcgacgctatgc
cgcgacgagggcgcgttcgccggcaccaactatctcaacccgccggtcggcacccaccct
tacggcgtggagggctacaagccgatcgccgccgaactcgctgcccagtgcgacaacctg
cccaccgacatcatcgtgcccacggcccggggcgatctgctgtggggcatctgcctgggc
tggcaggcgctgttgcggcgcggcgcgatcgcgcggctgccacgcctgcatgcggtggaa
ccctatccccgcctggcgcacgcgctggccgccggcgatgcgcgcggtgtgtgggaacag
ccgacggcgcagtattccatcgccggcggcaccgtgaccctgcaatcgatgcaggccctg
gcgcgcagcggcggacaggccgtggatgtcgcggacgaacaggccgcgcgggcccgcgcg
gcgctgggcgcgctgggcatcgccgccgagctgtcgtcggccgcggcgcttgccgccgtg
ccggcgctcaaggctgccggcgcgctggacgccgggtcgcgcgtggcgctgatcctgacc
tcggacgggcggcgcgactaa

DBGET integrated database retrieval system