KEGG   Bordetella bronchiseptica MO149: BN115_3680Help
Entry
BN115_3680        CDS       T02295                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BN115_3680
   00052 Galactose metabolism
    BN115_3680
   00500 Starch and sucrose metabolism
    BN115_3680
   00520 Amino sugar and nucleotide sugar metabolism
    BN115_3680
Enzymes [BR:bbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BN115_3680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4024833..4025672
Genome map
AA seq 279 aa AA seqDB search
MQVVRKAVFPVAGMGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAVAAGITDLIFVTGRN
KRAIEDHFDAAPELETDLEAKGKHELLALVRDILPAHVNCLYIRQSAPLGLGHAVLTAAP
AVGNEPFAVLLADDLIDADTPVLKQLIDVAVARQGSVLGVQEVPREDTRKYGIVASQPVD
ARTERVTHIVEKPAPEQAPTTLAVVGRYVLEAAIFDHLRATTVGAGNEIQLTDGIAALLR
ERDVYAHRYDGKRYDCGSKAGMFQATVALGRKYHGLIPE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttgtccgcaaagccgtctttcccgtggccggtatgggcacccgttttctgccc
gccaccaaggccatgccgaaggaaatgctgccggtcgtggacaaacccctgatccaatat
gccgtcgaagaggccgtcgccgctgggatcaccgacctcatcttcgtcacgggccgcaac
aagcgggccatcgaagaccatttcgatgccgcccccgagctggaaaccgacctggaagcg
aagggcaagcacgaactgctggcgctggtccgcgacatcctccccgcgcacgtgaactgt
ctgtacatccgccaatcggccccgctgggcctgggacatgccgtgctgacggccgcgccg
gcggtaggcaacgagcccttcgcggtgctgctggccgatgacctgatcgacgccgacacg
ccggtgctcaagcagctgatcgacgtggcggtggcgcgccagggcagcgtgctgggcgta
caggaggtcccgcgcgaagacacgcgcaaatacggcatcgtggccagccagccagtcgat
gcgcgcaccgagcgtgtcacccacatcgtcgagaaacccgcccccgagcaagctcccacc
accctggcggtcgtcggccgctacgtgctggaggcagccattttcgaccatctgcgtgcc
accacggtcggggcgggcaatgaaatccagctgacggacggtatcgccgcgctgctgcgc
gaacgcgacgtctacgcgcaccgctatgacggcaagcgctacgactgcggcagcaaggca
ggcatgttccaggccaccgtggccctgggccgcaaataccacggcctgattccggaataa

DBGET integrated database retrieval system