KEGG   Bordetella bronchiseptica MO149: BN115_4222Help
Entry
BN115_4222        CDS       T02295                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bbm00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4620839..4621864
Genome map
AA seq 341 aa AA seqDB search
MLHLAKFPRIKLGHFPTPLEFMPNLTRHLGGPNLYIKRDDCTGLATGGNKTRKLEFLVAQ
AVAQGADTLITQGAVQSNHARQTAAAAARVGMKCKILLEERVPHPDDDYSHSGNVMLDGL
MDGEIVARLPAGTDMQQAMEDLARELAGRGSKPYVIAGGGSTPVGALGYVACAQELLHQS
FETGLRIDHVVHATGSAGTQAGLVVGLRAGNSGIPVYGISVRAPKPRQEENVWKLVQSTV
DYMGLSASAVERADVVANSDYVGEGYGISTDAMIEAVHMTAALEAILLDPVYSGKGMAGL
IGLIRSGHFKQGENVVFVHTGGAVGLFGYRRAFEGLPPLAA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctacatcttgccaagtttccccgcataaaactcgggcacttccccaccccgctcgaa
ttcatgcccaacctgacccgccacctgggcggaccgaacctctacatcaagcgcgacgac
tgcaccggcctggccaccggcggcaacaagacgcgcaaactggagtttctggtggcccag
gccgttgcgcaaggggcggatacgctgatcacccagggcgccgtccagtccaaccacgcg
cgccagaccgccgcggccgccgcgcgcgtcggcatgaagtgcaagatcctcctggaagag
cgcgttccgcatccggacgatgactactcccactccggcaacgtcatgctcgacggcctg
atggacggcgagatcgtggcgcgcctgcccgccggcaccgacatgcagcaggccatggaa
gacctggcccgcgaactggccgggcgcggcagcaagccctacgtcatcgccggcggcggc
tcgaccccggtcggcgcgctgggatacgtggcctgcgcgcaggagctgctgcaccaatcg
ttcgaaaccgggctgcgcatcgaccatgtcgtgcacgcgaccggcagcgccggcacgcag
gccgggctggtggtcgggctgcgcgcgggcaacagcggcattccggtctacggcatcagc
gtgcgggcgcccaagcccaggcaggaagaaaacgtctggaagctggtgcagtccacggtc
gattacatggggctgtccgccagcgcggtggagcgcgccgacgtggtggccaattccgac
tacgtcggcgagggctatggcatctccaccgacgcgatgatcgaggcggtgcacatgacc
gccgcactggaagccatcctgctggaccccgtctactcgggcaaaggcatggccggcctg
atcggattgatccgttcgggtcatttcaagcagggcgagaacgtagtgttcgttcacacg
ggaggcgcagtaggcctgttcggttaccgccgcgcattcgaaggcctgcctccattggcc
gcctag

DBGET integrated database retrieval system