KEGG   Bordetella bronchiseptica MO149: BN115_4296Help
Entry
BN115_4296        CDS       T02295                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein (periplasmic)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bbm  Bordetella bronchiseptica MO149
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4698031..4698870)
Genome map
AA seq 279 aa AA seqDB search
MSGPSFSGAGMNFRITVWCAAAAVWSSGALAQDGAGQAAPGTPDKVYSTTGTAPAKPGDK
VYSTRSAQAPDPQADAVKERFAQRFEGFDVTAVRRTPYGLFEVQIGTDLLYTDEKVTWVM
EGPLIDALTRRDVTRERQEKLSSVPFDELPLDLAVKQVKGDGSRVMAVFEDPNCGYCKQL
HRTLEDMDNITVYTFLYPILSPDSTTKVRDIWCASDPAKVWKDWMVRGQRPPTAECDAPV
DQWLALGRQLMVRGTPAIFFKSGGRVSGALPRDELEARL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgggccgtcgttttcaggagcaggtatgaatttccggatcacagtctggtgcgcc
gccgccgcggtgtggagctcgggcgccctggcgcaggatggtgccggccaggccgccccg
ggcacgccggacaaggtctactcgaccaccgggaccgcgcccgccaagccgggcgacaag
gtgtattccactcgttcggcgcaggcgcccgatccgcaggccgacgcggtcaaggagcgg
ttcgcgcagcgcttcgaggggttcgacgtgacggcggtgcgacgcaccccgtacggactg
ttcgaagtgcagatcggaacggatctgctgtacaccgatgaaaaggttacctgggtcatg
gaagggccgctcatcgatgccctgacccggcgcgatgtcacgcgcgagcgccaggaaaaa
ctgtccagcgtcccgttcgacgagttgccgctggacctggcggtcaagcaggtcaagggc
gatggttcgcgcgtgatggccgtattcgaggatccgaactgcggctattgcaagcaactg
caccgcacgctggaggacatggacaacatcacggtctacaccttcctgtatccgatcctc
tcgccggactcgacgaccaaggtgcgcgacatctggtgcgcttcggatcccgccaaggtc
tggaaagactggatggtgcgcggccagcgtccgcccaccgccgagtgcgatgcgccggtc
gaccaatggctggcgctgggccgccagttgatggtgcgcggcacgcccgcgattttcttc
aagagcggcggccgcgtcagcggcgcgctgccgcgcgacgaactcgaagcgcgtctgtag

DBGET integrated database retrieval system