KEGG   Bordetella bronchiseptica MO149: BN115_4305Help
Entry
BN115_4305        CDS       T02295                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
bbm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbm01100  Metabolic pathways
bbm01110  Biosynthesis of secondary metabolites
bbm01130  Biosynthesis of antibiotics
bbm01230  Biosynthesis of amino acids
Module
bbm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BN115_4305 (trpC)
Enzymes [BR:bbm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BN115_4305 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CCJ61061
Position
4706744..4707532
Genome map
AA seq 262 aa AA seqDB search
MNDILAKILAVKAEEVATARQMRSEAELLREAQARQDVRGFAQAIEDKISQGKAGVIAEI
KKASPSKGVLRENFDPAEIAASYAMHGAACLSVLTDVQFFQGSHDNLRRARAACSLPVLR
KDFIIDPYQIISARAMGADCVLLIVAALAPAQLRDLETLAIDLGMDVLVEVHDAKELDAA
LALRTPLIGINNRNLRTFETTLQTTLDLLPMIPAGKRVVTESGILKPEDVRLMREHDVQA
FLVGEAFMRANDPGVELARLVA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatattcttgcgaaaatcctcgccgtcaaggccgaggaagtggctaccgcacgg
cagatgcgcagcgaggccgaattgctgcgcgaagcccaggcgcgccaggatgtacgcggc
ttcgcccaggccatcgaggacaagatcagccagggcaaggcgggcgtcatcgcggaaatc
aagaaagcctcgccttccaagggcgtgctgcgcgaaaacttcgacccggccgagatcgcg
gcgtcctatgccatgcatggcgcggcctgcctgtcggtgctgaccgacgtgcagttcttc
cagggctcgcacgacaacctgcgccgtgcgcgcgcggcctgctcgctgcccgtgctgcgc
aaggacttcatcatcgatccctaccagatcatttcggcgcgcgccatgggcgcggactgc
gtcctgctcatcgtcgcggcgctggcgccggcgcagttgcgcgacctggaaaccctggcc
atcgacctgggcatggacgtgctggtggaagtgcacgacgccaaggagctggacgccgcg
ctggcgctgcgcaccccgctcatcggcatcaacaaccgcaacctgcgcaccttcgagacc
acgctgcagacgacgctggacctgctgccgatgattccggccggcaagcgcgtggtcacc
gaaagcggcatcctcaagcccgaagatgtcaggctgatgcgcgagcacgacgtacaggcc
ttcctcgtcggcgaggccttcatgcgcgccaacgacccgggcgtcgaactggcgcggctg
gtggcctga

DBGET integrated database retrieval system