KEGG   Bordetella bronchiseptica MO149: BN115_4378Help
Entry
BN115_4378        CDS       T02295                                 

Definition
2-oxo acid dehydrogenases acyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:bbm01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bbm00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bbm00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bbm00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4779041..4780306)
Genome map
AA seq 421 aa AA seqDB search
MSQLNDLLMPKLGLTMTEGMLIEWSVTSGAEVKAGDSLFVVETDKVANEIVAQADGTLAE
ILVAAGETVPVGTVVARWTGPGQGADDMADAPPAPAPAAQPAAEAAEAAPAVARQPARGG
RVVATPLARRLAREAGLDLAQVSGSGPGGRIKAADVRQAPRAPEAAPAVSPDTAAPAPAA
RAPLAPVAGERRIEASALVQSMARRMTQAKQVPHFYLSAEAEVSALLALRQRLNAQADAP
RLTLNHFVIAAVARALAAMPHQNRIWNDDHIVQFQGIDVGVAVSTERGLMAPVLHGLDHA
SLDDIAAQSDALLVRVRAGKATREDMSGGAISISNAGMFNVTYMAPIINPPQSAILGVGS
IRELFRPDEQGAPALRREMGLVLAADHRLHDGASALAFLNHVIDLLQDPYRLLRNRPHTK
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagccagttgaacgacctgctcatgcccaagctgggcctgaccatgaccgaaggcatg
ctgatcgagtggagcgtgaccagcggcgccgaggtcaaggcgggcgattcgctgttcgtg
gtggagacggacaaggtcgccaacgagattgtcgcgcaggccgacggcacgctggccgag
atcctggtcgccgccggcgagacggtgccggtgggcaccgtggtggcgcgctggaccgga
cctggccagggcgcggacgacatggccgacgcgccgccggcgccagcgccggcggcgcag
ccggctgccgaggccgccgaggcggcgccggccgtggcgcgccagcccgcgcgcggcgga
cgcgtcgtggccacgccgctggcgcggcgcctggcgcgcgaagccggcctggacctggcg
caggtcagcggttccgggccgggcgggcgcatcaaggccgccgacgtgcgccaggccccg
cgcgcgccggaggcagcgccggccgtgtcgccggatacggccgcgcctgcgccggccgcg
cgcgcgccgctggcgcctgtcgccggcgaacggcgcatcgaggccagcgcgctggtgcag
tccatggcccggcgcatgacgcaggccaagcaggtgccgcatttctacctctcggccgag
gccgaggtcagcgcgctgctggcgctgcgccagcgcctgaacgcgcaggccgacgcgccg
cggctgacgctcaaccacttcgtcatcgcggcggtggcgcgcgcgctggcggccatgccg
caccagaaccgcatctggaacgacgatcacatcgtccagttccagggcatcgacgtgggc
gtggcggtctcgaccgagcgcggcctgatggcgccggtgctgcacgggctggaccatgcc
tcgctggacgacatcgccgcgcaatccgacgccctgctggtccgggtgcgcgccggcaag
gccacccgcgaagacatgagcgggggcgcgatctccatttccaacgccggcatgttcaac
gtgacatacatggcgcccatcatcaacccgccgcaatcggccattctcggcgtgggcagc
atacgcgagctgttccggcccgacgagcagggcgccccggcgctgcggcgcgagatgggc
ctggtgctggccgccgaccaccggctgcacgacggcgccagcgcgctggcgttcctcaac
cacgtcatcgacctgctgcaagacccgtaccggctgttgcgcaaccgaccccataccaaa
ggatag

DBGET integrated database retrieval system