KEGG   Borrelia burgdorferi N40: BbuN40_0791Help
Entry
BbuN40_0791       CDS       T02075                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
bbn  Borrelia burgdorferi N40
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bbn00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
827866..828969
Genome map
AA seq 367 aa AA seqDB search
MGFCLDFANKEDTKLNNIVSVSHFDFRVKINLILVVGPMGSGKTEYAAKIYKDSLVVRKK
SFKVLGNIIKGNRSRVNVFFIRNFLDKRRFQDYPENVIPYRGGGKDKIDEIGYASNSFDI
ENLIASNPSCGTFIIDEACFYDERLIFVLNKISSNENILFILPTLLYNFRKESFNDTAKL
LVEYSDKIYKLGAYCGHIDCMEESFFSYRYYFYNNKEIPAPYFDPLLIVGGDEEIESAIY
PNYSTRCSMHHYLIGKEYFFSFLKPFALLYSQGDKKFLENEIVALSTDVENSNFVNSLDS
EKACEFRAEILRNILELPFLAERALITLFSEYSILSKDNFKDLVFKFSLNKDYINKIFFS
KEGKEFF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
ttgggtttttgtttagactttgctaataaagaagatactaaattaaataacattgtttct
gttagtcattttgattttagggtaaaaataaacttaattcttgtagttggacccatggga
agtggaaaaacagaatatgctgcaaaaatttataaagattcgcttgttgtaagaaaaaaa
tctttcaaggtattgggcaatattattaaaggaaatagaagtagggttaatgtatttttt
attagaaattttctcgacaagaggaggtttcaagattatccagaaaacgtaataccatat
agaggtggtggaaaagataaaattgatgagattggttatgctagcaactcttttgatatt
gaaaatttaatagcctctaatcctagttgtggcacttttattattgatgaggcatgtttt
tatgatgaacgtttaatttttgttttaaataaaatttcatcaaatgagaatattttattt
atattacctacactgctttataattttagaaaagaatctttcaatgatactgccaaactt
ttagtagaatattcagataagatttataagcttggagcttattgtgggcacattgattgc
atggaagaatcttttttttcgtataggtattatttttacaacaataaagaaattccagct
ccttattttgatcctttgcttattgttggtggcgatgaagagattgaatctgctatttat
ccaaattactctacaagatgttcaatgcaccattatcttataggtaaggaatattttttt
tcttttttaaagccatttgctttgctatattcacaaggagataaaaaatttcttgaaaat
gaaattgtagcgctaagcactgatgttgaaaattctaattttgtaaattctttagatagt
gaaaaagcgtgtgaatttagagctgaaattttaagaaatattttagaattgcctttttta
gcagaaagagccttaataactcttttctcagaatatagtattttgagtaaagataatttt
aaagatcttgtttttaagttttctttaaataaggattatataaataaaatttttttttcc
aaagagggcaaagagtttttttaa

DBGET integrated database retrieval system