KEGG   Babesia bovis: BBOV_I002330Help
Entry
BBOV_I002330      CDS       T01085                                 

Gene name
19.m02062
Definition
flavodoxin and oxidoreductase NAD-binding domain containing protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
bbo  Babesia bovis
Brite
Enzymes [BR:bbo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BBOV_I002330 (19.m02062)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 661 aa AA seqDB search
MIITSTVLFYVAYYVWNSNSESTDDANKKENDNETNNNTTEKASNTNIEADNADVSKKIV
VYYGSQTGTAERFAKTLAHRLADWNSIFQRSSVNLEEFDEHDLLRPNTIAIFLIATHDDG
HFPDNAERFVRWLRLMEDESKRLECLEYCIFGLGSTEYPQFNNASKNLNNILINLGAKAL
LPIKLGDDATDLKSDFEEWSRDVCNALAKRLVIEPVSETFYEKPLLVSLKETWRDCVPLE
LRYLSKDQIKSDCTPISATVVCKQQWQCVDHVVIDNINMTPESEETTNMLTIESYGEFNA
AETINVLYANPPKVVSYFMDKLNIKEQDMEKLITFVPRYATVDTQMNFEAPFPIPCTIGD
ALRYYLDLTGLPDEETLRNLGTFLQSNHSCQYLNKLFKRKALMKIMKEELHLTLQEFIEI
FMHDAIFNIGGFLQIIPKKVTKAYTVSSHPKTNKIDLTIKLVKKRNFTFKTFKSRIQKEI
GYEVRPGTEKMFALHRMYKGACTHYLCSLQKGDVVKLYKRPSAFSLISDIFDKPLVMIAN
GSGIAPFRALWQQGNTTHRRIIFFGFRDEQHILYKEEIEGLKNMPNYSVNIALSRTGKHE
YVQHILRNHIIQVQDILNSSGLIYVCGSKAMGAQVKAMLQHFLKIDIAVLKTQQKYVEEL
W
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgattataacgtccacggttttgttttacgttgcgtattacgtctggaatagtaacagc
gaaagcacagatgacgcgaacaaaaaagagaacgataatgaaactaacaataataccact
gagaaagcctcaaatacgaatatagaagcggataatgccgatgtgtcgaagaaaatagtc
gtatactatggcagtcaaaccggtacagcagagagattcgccaaaacccttgcacatcgg
ctagcagactggaactcaatattccaaagatctagcgtcaatctagaggaattcgatgaa
cacgatctactccgccctaataccatcgccatatttctaatagcaacgcatgatgatgga
cactttccagacaatgctgaaagatttgtaagatggctaaggttaatggaagacgaatcc
aaaagactggaatgtcttgaatattgtatcttcggactgggtagcactgagtatcctcag
tttaataatgcatccaaaaatctcaacaatatattgatcaatctgggtgccaaagcactt
ttaccaataaaattgggtgacgatgcaaccgatttaaaaagtgactttgaagaatggtca
cgagatgtatgcaatgccttggcaaaaaggctcgtgatagagcctgtttcagaaacattt
tacgaaaaaccattactcgtaagcctaaaagaaacctggagggattgcgtgccgttagag
ttaagatatctgtccaaagatcagataaagagcgattgtacacccataagtgctactgtt
gtatgcaagcagcaatggcaatgtgtagatcatgtggttatcgataacatcaatatgaca
ccagaaagtgaagagacgacaaatatgctaacaatcgaatcatatggtgaattcaatgca
gctgaaacgataaacgtattgtatgcaaatcctcctaaggttgtatcgtatttcatggat
aaactaaatataaaagaacaagatatggaaaagctcatcacatttgtaccgagatatgca
acagtagacacacaaatgaactttgaagccccgttcccaataccatgcacaattggtgat
gcattgcgttattatttggacctcacgggattgccggatgaagaaacgttacgtaacttg
gggacattcttgcaaagcaaccactcatgtcaatacctcaataaactcttcaagagaaaa
gctttgatgaaaataatgaaagaggaattgcacttgacgctgcaagagtttattgaaatt
tttatgcatgatgcaatattcaacattggaggctttttacaaattatacccaagaaggta
acaaaagcatatactgtatcttcccatccaaagacaaacaagattgatttaacaataaaa
cttgttaagaaaaggaattttactttcaaaacattcaaatcgagaattcaaaaggagatc
ggctacgaagtaaggccaggcacggaaaaaatgttcgctttgcatcgcatgtataaagga
gcttgtactcattatttgtgttcgctccaaaagggggatgtagtaaaactatacaagaga
ccatctgctttcagcctaatcagcgatatattcgataagccattggtcatgatagcaaac
gggtcaggcatcgcaccattcagagcattgtggcaacaggggaacacaacgcaccgacgc
ataatattcttcggtttcagagatgagcaacatatcttgtataaggaagaaattgaaggt
ttaaagaacatgccgaactacagtgtaaacatcgcactttctagaaccggaaagcacgaa
tacgtacaacatatattacgaaaccacattatccaagtgcaagatattctaaactcaagc
ggattgatatacgtgtgtgggagcaaagccatgggtgcccaggtcaaagcaatgcttcaa
cattttctgaagattgacattgctgtgctaaaaacgcaacaaaaatatgtcgaagaactt
tggtag

DBGET integrated database retrieval system