KEGG   Babesia bovis: BBOV_I003300Help
Entry
BBOV_I003300      CDS       T01085                                 

Gene name
19.m02166
Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bbo  Babesia bovis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bbo00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 754 aa AA seqDB search
MLVISLALPLYLLQAAICCADRAVPDYEARYGTQLVPLKADEHYNEKLSRLAFGSCQKLH
LGNNGIFQRIIDSNPDLFLYTGDIVYPEYGCCSPKCLQSKYEQLVSHPVYQHFKANIRRI
DGVYDDHDLGINDGHANYRYKKEALEQLLDFLGKPKDHYRRKREGAYYSAEYVDPATNKK
VFTYYPITESWGLLPQAKDRLVDLLLAAKPKNTVFVSGDVHWGEIMERDGIVEITSSSLT
HSLLLEAPMLKIPMIVVSSLWKKSTYGYNNFGIIDFDVNKENGNITQEVKLMDEYGNVLQ
RSFNDGSSDPLEPYIGVKYKENTFLNNTRIVKCTSLKWKFGLLFSVMLLVACSVAIVHSV
IRSFIFARIKYRTYKYGINHPVANGCCEPHCLKKEYDELIASKDYRDFAASFKYIDGMYD
DHDFGVNDGHKTYAYREHSQKYLLDFFNKPEDHYRRKRKGAYFSMLFSDPDNPKHKVKLI
VLDVRYHRECYYYCACDTCKWLRIHTNKFATIRLINYFFGFGCNHPGDTLGAEQWKWLQG
QLHGSTAEAHIIVSSFQIFTRFPLTESWGLLPLAKDRLVDLLLTTKPKNPIFLSGDVHYG
ELNEKDGVVEVTSSSLTHSFLEHGTSPYRPFAISIFATKPNAYMYNNFGGVEFEYDRQHK
TLKWSTKIFDVNGKVVTEYTSDASRDLSDIYRNVDKKKRSFFTNTRIVKCRGLLWRISLA
YGILCLVTWMVLIPYVALVRLYRILVGTRKEKHH
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgatatcattagcgttgccactttatctgttgcaggctgctatatgctgtgct
gatagagctgtaccagattatgaagcacggtatggtactcaactggtaccactcaaggca
gatgaacattataatgaaaaattgagtagactagcattcggaagttgccaaaaattacat
ctaggcaacaacggtatattccaaagaattatagatagtaatcctgacctattcctatat
acaggtgatattgtgtatccagaatacggttgctgcagccctaaatgcttgcaaagtaaa
tatgaacaattggtgtcacatcctgtataccaacatttcaaagcgaatatacgtcgtata
gacggtgtctacgatgaccacgacctgggtatcaatgacggccatgcaaactatcgatat
aaaaaggaagctttagagcaactattggattttctaggtaaacctaaagatcactatcga
cgtaaacgagaaggagcgtattattccgctgaatacgttgatcccgcaacaaacaaaaag
gtattcacctactacccaataacagagagttgggggcttctaccacaagccaaggatagg
ctagtcgatttgctactagcagcaaagcccaaaaatacagtattcgtctctggagatgtt
cactggggagaaatcatggaaagagatggtatcgtggaaattacatccagcagtctcacc
cactcgttgcttttggaggcacccatgctaaagattccaatgatagttgtatcctcactg
tggaaaaagagtacatatggatataacaacttcgggatcatcgattttgatgtgaataaa
gaaaatggaaatataacacaggaagtcaagctaatggatgaatatggaaacgtattgcaa
aggagtttcaacgatgggtccagtgatccgttagagccgtacattggagtgaaatataag
gagaatacattcctaaacaatactcgcatcgtaaaatgcacgtccttaaaatggaagttc
ggattgctgttttcagtgatgctactagtggcatgctctgtagctatcgtccactctgta
atacgaagcttcatatttgcaagaattaagtatcgcacatataaatacggtattaaccat
cccgtagccaatggatgctgtgaaccgcactgtctaaaaaaggagtatgatgaattgatt
gcatcgaaagattaccgtgattttgcagcatcatttaaatacattgacggaatgtatgat
gatcatgactttggagtgaatgacggacacaagacatacgcatatcgtgagcatagccaa
aaatatctacttgattttttcaataaacccgaggatcactatcgccgcaagagaaagggc
gcttacttctctatgctctttagtgaccctgataaccccaaacacaaggtgaaattgatt
gttctcgatgttagataccatcgagaatgctactactactgtgcgtgcgatacctgtaaa
tggcttaggattcatacaaataaatttgccaccatccgcttaatcaactacttcttcggg
ttcggttgtaatcacccaggtgataccctcggagctgaacaatggaagtggctacaagga
cagttgcacggatcgactgctgaagcgcacattattgtatcgtctttccaaatattcact
cgcttccctttgaccgaaagctggggactactaccactggcaaaggacaggctggtagac
cttctattaacaactaaacccaaaaatccaatctttttgtcgggagatgttcactacggt
gaacttaacgagaaggacggcgtggttgaagttacatccagtagtcttacacattccttc
ctggaacatggaacaagcccataccgtccgtttgcaatatctatatttgccacgaagcct
aatgcctacatgtacaacaacttcggaggtgtggaatttgaatacgaccgtcaacataaa
acattaaaatggagtacaaagatctttgatgttaatggaaaggtggtgactgaatacaca
tcagatgcttcacgtgacctgagcgatatttaccgcaatgtagataaaaagaaacgttcc
ttctttaccaacacacgtattgtcaaatgccgcggccttctatggcgtatatcgttggca
tatggcatactctgtctggttacctggatggtgctcataccctatgtcgcgctagtgcgc
ctctataggattcttgtgggtacccgcaaggaaaagcaccattaa

DBGET integrated database retrieval system