KEGG   Babesia bovis: BBOV_I003660Help
Entry
BBOV_I003660      CDS       T01085                                 

Gene name
19.m02033
Definition
aspartate transcarbamoylase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bbo  Babesia bovis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BBOV_I003660 (19.m02033)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BBOV_I003660 (19.m02033)
Enzymes [BR:bbo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BBOV_I003660 (19.m02033)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 383 aa AA seqDB search
MKMANSNNLVMSILGAGAVGVAIAYAASKSTKVRRFLVSCGICNSNPMADALEPQMRKVA
KAMGSINILSVDDLSNQQIICLMELANFFKEKVSQKEDCQVLPNNIMVTLFMEPSTRTRC
SFEAAMLRLGGKVISIADASTSSTAKGESEEDSVKVLSSYADVVVMRHSEKGIMERIKEH
VKVPLINAGDGQGEHPSQALLDLYTILTYFPIMETNNERAFTICFVGDLKNGRTAHSLAK
LLSRYNVVMRYVAPTQLQMPTEIQREVENNFAKYNIPDLPLSRQTSFSQLEDACEGADVI
YVTRLQKERMDSQGAKGLLGSYGIQKTLLPKLMKHVKIMHPLPRIDELPPEIDNDERAIY
FEQAQNGLYVRMAMLYLILNSKR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggcaaactcaaataacctagtcatgtccatcctaggggcaggagccgtagga
gtagcaattgcgtatgcagcgtcaaagtcaacaaaagtaagaaggttcctagtaagctgc
ggtatatgcaatagtaacccaatggcagatgcattggaaccacaaatgagaaaagttgca
aaagccatgggatcaatcaatatactctcagtagatgatctctcaaaccaacagatcata
tgcctaatggaactggcaaacttcttcaaagaaaaagtatcgcaaaaagaagattgccaa
gttctaccaaataatatcatggtcacactattcatggaaccaagcacaagaaccagatgc
tcattcgaagcagctatgctcaggttgggagggaaagttatatcaattgcagacgcttca
acatcgtcgacggcaaaaggagaatccgaagaggattctgtaaaagtattgtcatcatat
gcagatgttgttgtcatgagacattcggaaaagggaattatggaaagaataaaagaacat
gttaaagtaccattgatcaacgcaggtgacggacaaggagaacacccaagtcaagcacta
cttgacctgtacacaattttaacgtacttcccaataatggaaacaaacaatgaacgagca
ttcaccatatgcttcgtaggtgatttgaaaaatggaagaacagcacactcactggcaaaa
ctattaagcagatacaatgtagtcatgagatacgtagcaccaacacaactacaaatgcca
actgaaatacaaagagaagtggaaaataacttcgctaaatataatataccggatctgcca
ctctcaaggcaaaccagcttcagccaactggaagatgcatgtgaaggagcagatgttata
tacgtaacaaggttacaaaaagaaagaatggacagccaaggagccaaggggctactaggg
tcatacggaatacaaaagacattactacccaaattgatgaaacatgtcaaaatcatgcac
ccactaccgaggatagatgaattgccgccagaaatagataatgacgaaagagctatatac
ttcgaacaagcacaaaatggcctatatgtcagaatggcaatgctatacctcattttaaat
agcaaaaggtag

DBGET integrated database retrieval system