KEGG   Babesia bovis: BBOV_I003750Help
Entry
BBOV_I003750      CDS       T01085                                 

Gene name
19.m02034
Definition
histone acetyltransferase
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
bbo  Babesia bovis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 646 aa AA seqDB search
MVGYSGSSHADGTSRIDGERDPKRHIKEAQRIDKTNEPSHTTYSNNMANNTMDEGYIAND
TSITSLVRNVVRLYVGDCKIRPNPFTSNFETKLENKRIPATNRLHLSGVDVTALVNFSLE
RVPEGKRQELLELRKVLAESDSQSINVLVKSVCAIIGYQQLLTPEARKNFNDEHLQDWIK
SHDAEVFMDKNYERIYIRWKNFLKRQTPLGTNLCDYFCGDFLKSLLIINADRLRSELEKT
VFKYHPDMIITLLCKECGLTDEQAKTIGTMSSADGYQLQSVLPSETGLGFLHRDAGGAKE
EDLGIISFDCITNDREPGHLIKLVTVKNIFSRQLPKMPREYIVRLVFDRNHYTFCLLKKG
EVIGGICFRPYFEQRFAEIAFLAVKSTEQVKGYGTRIMNHLKEHVKKSNIEYFLTYADNF
AIGYFRKQGFSQKISMPKERWFGYIKDYDGGTLMECYISPNINYLRLSDMLGKQKAIISQ
CIEAIKPLKVYDGLTFFKENPGITINPRDIPGLVEAGWTDDVVPSSKHGPDSHAGADDPD
GKKTLKNAILDLLNNLEKQQSSWPFRKPVKQSEAPDYYDIIKNPTDISTMKKKAKNGEYK
TKSQFGEELKRMFDNCRKYNTPHTIYYKYANELQAFIWPQYENIQE
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggtaggatattcaggcagttcccatgcggatgggacttcacgaatagatggtgaacgc
gaccccaaacgacatataaaggaagcacaacgaatcgacaaaacgaacgaaccatcgcac
actacatactccaataatatggcaaacaataccatggacgaaggatatatcgcaaatgat
acttcaataacatcactcgtaaggaatgttgtgcgtctctacgttggagattgtaaaatc
cgtccaaatccgtttacttctaattttgaaacaaagttagagaacaaaaggatacctgcc
acgaatcgcctacacctcagcggcgttgatgttactgctctcgtcaatttctcgctggaa
agagtaccagaggggaaaaggcaagaattactcgaactcagaaaagtattagctgaatca
gattctcaaagtattaatgtattagtaaaaagcgtatgtgctatcataggatatcagcaa
ctcctgacaccggaagcgaggaagaatttcaacgatgagcatttacaagactggatcaaa
tcacatgatgctgaagttttcatggacaaaaactatgaaagaatatatatcagatggaag
aacttccttaagaggcaaacacccctgggaacgaatctgtgcgactatttttgcggagat
ttccttaaatcgctcctgataatcaatgctgatagattgcgatcagagcttgaaaaaacc
gtctttaaataccatcctgatatgattataacattgctttgcaaagaatgtggtcttaca
gatgaacaggcaaaaacaataggtaccatgagcagtgctgatggataccaactgcaatct
gtccttccctctgaaacgggtttaggtttccttcacagggatgctggcggtgccaaagag
gaggatctaggtatcatatcatttgattgtatcaccaacgacagagaacctgggcatttg
ataaaattagttacggttaaaaacatattttcgagacagttacctaaaatgcctagagaa
tatattgtgagattggtatttgataggaatcattatactttttgtttactaaagaaaggt
gaagttattggtggaatttgttttagaccttattttgagcaaaggtttgcagagattgct
tttcttgctgtaaaatccactgaacaagtcaaaggttatggtacacgtattatgaaccat
ctgaaggagcatgtaaaaaagtcaaatatcgagtatttcctaacgtatgccgataatttt
gccattggctatttcagaaaacaagggttctcacaaaagatatccatgccaaaggaacgt
tggtttggctatatcaaggattacgatggaggtacacttatggaatgctatatttccccc
aatataaactatttaaggcttagtgatatgctgggtaaacaaaaggcaattatatcccaa
tgcatagaagccatcaagcctttgaaagtgtacgatggattaacattcttcaaggaaaac
ccgggtattactataaatccgagagatattccaggtttagtagaggctggatggactgac
gatgttgtaccaagcagcaaacatggaccagattctcatgctggcgctgatgatcccgat
ggtaagaagacgctgaagaacgctatactggaccttttgaataaccttgagaaacaacaa
agttcttggcccttcagaaagcccgtaaagcaatcggaagctccggattattacgatatc
atcaaaaaccctacggatatatctacaatgaaaaagaaggcaaagaatggagaatataaa
accaaatcacaattcggagaagaactcaaacgcatgttcgataactgtaggaaatataac
acacctcataccatctattacaagtatgctaatgagctacaagcgttcatttggccacaa
tatgagaacattcaagagtga

DBGET integrated database retrieval system