KEGG   Babesia bovis: BBOV_I004170Help
Entry
BBOV_I004170      CDS       T01085                                 

Gene name
19.m02075
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bbo  Babesia bovis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bbo00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 503 aa AA seqDB search
MKVIVAIDQGTQSTRCIFYNEKMQVLVTSSKTHKQHYPQSGWCEHDPLEIIENVYGTMND
ALEQMRSKWESFEIVSVGITNQRETIVAWDAATDKPLHNAIVWLDIRAEAEVAEFIEKYG
SPTHFIEKTGLVINPYFSAFKLAWMSKNLPWFKEAVENETIRFGTMDSWIIYNLTGNYVT
DITNASRTFLMDIDKCIWSTEMLRVFGLNSKVLPEILPNCAEFGLINNTHVSGFKGVRIT
ASIGDQQSACVGHGLLDQGTAKLTLGTGGFILINTGKDKVKSFDGLLSTPCYKTGNDSDT
IYALEGSIAIAGAGITWLQDMGIIKHPAEVSDLLKECKCSEGVVFVPAFSGLFAPRWRSD
ARGSILGMTQRTKRMHIVRAFCESIGFQLREIILSFIKDMNIEKVPYICVDGGVSKNSEL
LQVISDITNTPLESPEMVEATCAGAAMLAGLQAKVWGSLEEVRQLTTKQRKRWDPQMSDP
QRNNAVNYWNLGVNRSLSWQLSM
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaattgtggcaatcgatcaagggacgcagtccactcgatgcattttctacaat
gaaaaaatgcaagttttagtaacatcatctaagactcacaagcaacactatcctcaatca
ggatggtgtgaacatgatcctttggaaatcatagaaaatgtatatggcaccatgaatgat
gccttggaacaaatgagatccaagtgggaaagctttgaaatcgtaagcgtaggcataact
aatcaaagggagaccatagtggcgtgggatgcggcaacagataagcctttgcacaacgca
atagtgtggctagacattcgtgccgaagcagaagtggcagaatttattgaaaaatatgga
tctcccacgcacttcattgaaaagactggattagtgataaatccctatttttctgcattc
aaattggcatggatgtcaaaaaatcttccatggttcaaagaagctgtggaaaatgaaaca
atccgttttggaacaatggattcctggatcatctataacctaacaggaaactatgtaaca
gatattaccaatgcatcaaggacattcttaatggatatagataagtgtatatggagcacc
gaaatgctgcgtgtgtttggtttaaattccaaagtgctacctgaaatactaccaaattgt
gccgaattcgggcttatcaacaatactcatgtttccggattcaagggcgtcagaatcacc
gcgtccattggtgatcaacagtcagcatgtgttggacatgggttgttagatcaaggcaca
gctaaacttacgttgggaactggaggttttatattgatcaacacgggtaaagataaggtt
aaatctttcgatggattactgtcgacaccgtgttacaaaacgggaaatgactcagacacc
atttatgcattagagggatccattgccatcgccggagctggaataacgtggttacaagat
atgggaattataaaacatccagctgaagtatcagatctattaaaggaatgcaagtgctct
gaaggagtcgtgtttgtcccagccttttctggtttattcgctcctagatggagaagcgat
gcaagaggctccatactaggaatgacacaacgtacaaaacgaatgcatatagtgagagct
ttctgtgaaagtataggattccaattacgtgaaataatcttatcattcataaaggatatg
aatatagagaaagtcccatatatttgtgttgacggtggagtatctaagaactctgaattg
ttgcaagtcatatcggatataacgaatacaccattggaatcacctgaaatggtagaagca
acctgtgcaggagccgcaatgttagctgggcttcaagcaaaggtctggggaagtttggaa
gaggttcgacaattgacaactaaacagcgcaaaagatgggacccccaaatgtccgatcct
caaagaaacaatgcagtaaattattggaatcttggagtaaatcgttctctttcctggcaa
ttatcaatgtga

DBGET integrated database retrieval system