KEGG   Babesia bovis: BBOV_I004190Help
Entry
BBOV_I004190      CDS       T01085                                 

Gene name
19.m02221
Definition
cAMP-dependent protein kinase (EC:2.7.11.1)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
bbo  Babesia bovis
Brite
Enzymes [BR:bbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     BBOV_I004190 (19.m02221)
Protein kinases [BR:bbo01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   BBOV_I004190 (19.m02221)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 416 aa AA seqDB search
MGVTYSITNGIDTGMGAYENKNHVNKETSYSVVQSTRRLPQPQTAPRISRFMARCNNIAK
HMICTNDSMASDVRYKAWTESDTISDGTMEIIPSLPEKLDISNFDIGPIVGTGSYATVCI
ATLNTGPKSQRATFALKILHKTKVIAERQVMHLRNERHILSTVRHPFIVNYVKSFQDDIN
VYILLEYVSGGELFSYIYKYGALGHTVARFYTAQAILAIDFLHFKGIVYRDLKPENMLLD
QDGHIRLVDFGFAKEVKHKTYTVCGTHDYLAPEIFLRCGHGIEADWWSLGVLVYEILTGV
PPFHASDPSATYDLALANHIRFPLSVRVEVKDFIRRLLVVNPRKRLGGSNSSELYSHRFF
AGMDWMKLLSKQLKPPIVPRVSGLSDTTNYMQYPDDWRAHDARITRSQQDEYFSDF
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcacgtattccattaccaatggcatcgatacaggcatgggcgcttatgaaaac
aaaaatcatgtaaacaaggagacatcttacagcgttgtccaatcaacaagaaggttacct
caaccacagactgctccgaggatttcgaggtttatggctcggtgcaacaatatcgcaaag
cacatgatttgtacaaacgattctatggcctcagatgtacgttataaggcatggacagaa
tcagatacaataagcgacggtactatggaaataataccatcgctacctgagaaactggac
atttcaaattttgatataggaccaatagtaggaactgggtcatatgctacagtgtgcatt
gcgactctcaatactggtccgaagtctcagcgtgcaaccttcgcactaaagattttgcat
aaaacaaaagtcatcgctgaacgacaggtaatgcatctacgtaatgagagacacattttg
tcaaccgtcagacatcctttcatagtaaattatgtgaagagttttcaagacgatataaat
gtctatatattgttagaatatgtttctggaggagaattattcagttacatatataaatat
ggagccctagggcacaccgttgctcgattctatactgcacaagcgatattagctattgat
tttttacacttcaagggtatagtgtatcgtgatttaaagcctgaaaatatgctacttgat
caggacggccatatacgtctagttgactttggatttgccaaggaggtaaagcacaaaaca
tacacggtatgtggtactcatgactatcttgctcctgaaatattcctacgttgtggacac
ggtatagaagcagattggtggtcactaggtgtattagtatacgaaattttgacgggtgtt
cctccatttcatgcttccgaccctagtgcaacttatgacttagcgttggcgaaccacatt
cggtttccgctgtctgtgagggttgaggtcaaggacttcatacgtcgtttgctagtggtg
aacccgcgaaagcgtcttggtggtagtaacagctccgagctgtactcccacaggttcttc
gcgggtatggattggatgaaattgctcagtaagcagttgaagcctcctatagtaccacgt
gtatctggtttatcagacactactaactatatgcagtatccagatgactggcgtgcgcat
gatgcgcgtataacgaggtcacaacaagatgaatactttagcgacttttag

DBGET integrated database retrieval system