KEGG   Babesia bovis: BBOV_I004690Help
Entry
BBOV_I004690      CDS       T01085                                 

Gene name
19.m02237
Definition
cGMP dependent protein kinase (EC:2.7.11.1)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
bbo  Babesia bovis
Brite
Enzymes [BR:bbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     BBOV_I004690 (19.m02237)
Protein kinases [BR:bbo01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   BBOV_I004690 (19.m02237)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 887 aa AA seqDB search
MSKEQDELSHEFKKLHIVHSSTKAWKPNNYQGSKGVRSQPVNVAHNEECDEVSTLAKYAT
SRDKTDKDITLIRHALANNLVCESLNEYEIDAFIGSMSSFELPAGAPVVRQGDNGTYFFI
ISEGDFDVYVDGEHVNSMTRGTAFGEISLIHNTPRSATVKVKNKAGNCGKLWGVTRVVFR
DTLKRISLRNYTENREFIDCVTIFENLTEENKSCITNALVELRFSPGESIVKQGDPGDDL
YLIKQGSADVYVNDIRVRTITKGQYFGERAILYSEPRSATIKAIDYVICVSITRDILQSV
LGNLNNVLFRNIMMEGLQHSDVFKQFTGEQLCELIESASIRSFRKGAVILDRETLLKGIR
YFIVLEGSVRVLYDGNELGTMQRGDSFGEEYITHANLPFNHTVIADGGNVNVSKLAFFTK
HAMQLILGGENLSEKLDYNNKMAALRKIYILRHLSEKQIDMLIKALKTLRYKLNDTIFNE
GEIGDMLYIIKSGEVAIIKNGVKIRTLGKHDYFGERALLYDEQRSASVVSNATYVDLWVV
EKPVFMELMEPTMLQHLEKRIKMQDSKVQFHELKVIKTIGHGKDLGTFGTVKLVDHEPTG
VRFALKCVSRKCIRALKQQKHIKLEREIMAQNDHPFIIQLVKTFKDESNVYFLTELITGG
ELYDAIRKIGLLSRPQAQFYIASIVLAFEYLHERQIAYRDLKPENILLDEQGYIKLIDFG
CAKKIKGRAYTLIGTPHYMAPEIILGKGYGCLADIWSFGVCLYEFICGPLPFGNDARDQI
EIFRDILKGNLVFPEYVKDQEAINIIKRLLCRVPEVRLGSSINGFKDIKEHSYFRDFDWD
KLSGRALQPPFVPQGETYNEDEAQESAQSANETDESEHAGDDWEKDF
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaggaacaagatgagctcagccatgaatttaaaaaattacacatcgtacattct
tctacaaaggcatggaagcctaataattaccaaggctccaaaggtgtgcgatcgcaaccc
gtaaacgtcgcacacaatgaagagtgcgatgaagtctctacattggcgaaatatgcaaca
agccgtgataaaacggataaagacataacactaattcgtcacgctttggcaaataaccta
gtttgtgagtcactcaacgaatatgaaatcgatgcgttcatcggatccatgtcttccttt
gaactcccagcaggagcaccggttgtaagacagggagataatggtacgtactttttcatc
attagcgaaggtgactttgatgtgtatgtcgatggtgagcacgttaactcaatgacccgg
ggcaccgccttcggggagatatcgctaatccataatacgcctcgtagcgcaacagttaaa
gtcaaaaacaaagctggaaactgcggaaagctttggggagtaacaagggttgttttccgg
gatactctaaaacgaatatcgctccgcaactacacagaaaaccgtgaatttatagattgc
gtcaccatatttgaaaatctgacggaagagaataagagttgcatcaccaatgcacttgta
gaattgaggttttccccaggggaatccatagttaaacagggtgaccctggtgatgacctg
tatctcattaagcagggtagcgccgacgtctacgtaaacgacattagggttagaaccatc
accaaggggcagtacttcggtgaaagagctattctgtatagcgagcctcgcagcgcaact
ataaaggctattgactatgtaatatgcgtgtccataaccagggacatcctccaaagcgtc
ctgggaaacctcaataatgtactcttcaggaacatcatgatggaaggcctgcagcattcg
gatgtattcaagcagtttactggcgagcagttgtgtgaattgattgaatcagcaagcata
agaagcttcaggaagggtgctgtcatactcgatcgcgagaccctgctaaaggggattcgg
tatttcatcgtcctagagggatccgtacgcgtgctatacgacggtaatgaattgggtacc
atgcaacgtggagatagcttcggtgaggaatacatcacacacgccaatctaccgtttaac
catacagtcatagcagatggtggcaatgttaacgtctcaaagctcgcgttcttcactaag
catgcaatgcaacttatacttgggggagaaaatctaagcgaaaagctagattacaacaac
aagatggctgcgctgcgcaagatttacatattgaggcacctgtccgagaaacagattgac
atgcttatcaaggccctgaagacactaaggtataaactcaatgataccatcttcaacgaa
ggagagattggagatatgctatacatcattaaaagtggagaagtagccattataaagaac
ggagtaaagatacgtacactaggtaaacacgactactttggcgagcgtgcgctgttatac
gatgaacaaagaagtgcgtcggttgtgagtaatgctacttatgtagacctgtgggtagtg
gagaagcctgtattcatggagctcatggaacccactatgttgcaacacttggaaaagagg
atcaagatgcaggattccaaggtacaattccacgaactgaaggtgatcaagacaataggt
catggtaaggacttgggtacattcggcactgtcaaactcgtagaccacgaacccacaggg
gttaggttcgctttgaagtgtgtcagccgcaagtgtatccgagctctgaagcaacagaaa
catatcaagctagaaagggagatcatggcccagaacgatcatcctttcatcatccaacta
gtgaaaacatttaaagatgaaagtaatgtatacttcttgacggaactcatcactgggggt
gagctttacgacgccatcaggaagattggtcttttgtcaaggccacaggcacaattctat
atagcctccatagtgcttgcttttgagtatctgcatgagaggcaaatcgcatatcgggac
ctgaaaccagagaatattcttctggacgaacagggatatatcaaacttatcgattttggt
tgtgcaaagaagattaaaggaagggcttatacgcttataggcacgccgcattatatggct
ccagagattatattaggcaagggatatggatgtctagctgatatatggtcctttggggtg
tgtctatacgagtttatatgtgggccattgccctttggaaacgatgcacgtgaccagatt
gagatcttccgcgatattctgaaaggcaacctggtattcccagaatacgtcaaggaccaa
gaggctataaatatcatcaaaaggctgctgtgcagggtacctgaagttagattgggtagt
tccataaacggattcaaggacatcaaggaacattcgtacttcagggactttgactgggat
aagctatccggcagggctcttcaaccacctttcgtgcctcagggtgaaacttataacgaa
gacgaggcgcaggagagcgcccagtcagctaacgaaactgacgagagcgagcacgcagga
gacgactgggaaaaagatttttaa

DBGET integrated database retrieval system