KEGG   Babesia bovis: BBOV_II000780Help
Entry
BBOV_II000780     CDS       T01085                                 

Gene name
18.m06049
Definition
dihydrofolate reductase/thymidilate synthase (EC:2.1.1.45)
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
bbo  Babesia bovis
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BBOV_II000780 (18.m06049)
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BBOV_II000780 (18.m06049)
   00670 One carbon pool by folate
    BBOV_II000780 (18.m06049)
Enzymes [BR:bbo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BBOV_II000780 (18.m06049)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     BBOV_II000780 (18.m06049)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2
AA seq 511 aa AA seqDB search
MSNSYEGCGDLTIFVAVALNKVIGHKNQIPWPHITHDFRFLRNGTTYIPPEVLSKNPDIQ
NVVIFGRKTYESIPKASLPLKNRINVILSRTVKEVPGCLVYEDLSTAIRDLRANVPHNKI
FILGGSFLYKEVLDNGLCDKIYLTRLNKEYPGDTYFPDIPDTFEITAISPTFSTDFVSYD
FVIYERKDCKTVFPDPPFDQLLMTGTDISVPKPKYVACPGVRIRNHEEFQYLDILADVLS
HGVLKPNRTGTDAYSKFGYQMRFDLSRSFPLLTTKKVALRSIIEELLWFIKGSTNGNDLL
AKNVRIWELNGRRDFLDKNGFTDREEHDLGPIYGFQWRHFGAEYLDMHADYTGKGIDQLA
EIINRIKTNPNDRRLIVCSWNVSDLKKMALPPCHCFFQFYVSDNKLSCMMHQRSCDLGLG
VPFNIASYSILTAMVAQVCGLGLGEFVHNLADAHIYVDHVDAVTTQIARIPHPFPRLRLN
PDIRNIEDFTIDDIVVEDYVSHPPIPMAMSA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtctaattcatacgaagggtgtggagatcttacgattttcgtagccgttgccttgaat
aaggtaattggccataaaaaccaaattccctggccgcatattacgcatgattttcgtttt
ttgcgtaatggcacaacttacattccacctgaggtgttgtctaagaacccagatatacag
aatgttgtgattttcggtaggaagacttatgaaagtatccctaaagcttcgctccctctt
aaaaaccgtataaacgtgatactgtctcgtactgtcaaggaagttcctggttgtttggtg
tacgaggacctttctactgccattcgtgatttgcgtgcaaatgtccctcataacaagatt
tttatcttaggcggttcttttctttacaaggaggtgcttgacaatggtttgtgtgataag
atttatttgactcgtctcaacaaggagtatcctggtgacacctacttccctgatattccg
gatacttttgagataaccgccattagtcctacgttttccactgactttgtcagttatgat
tttgttatttacgagcgtaaggattgcaagactgttttccccgatcctccttttgatcaa
ttattgatgacagggactgacattagcgttcccaaaccaaagtacgttgcttgtcctggc
gtcaggatacgcaaccatgaagagttccaataccttgacatattggcagatgtgctaagt
catggtgtattgaagcccaaccgtaccggtactgatgcctactctaagtttggctatcag
atgcgatttgacctttcacgttcattcccgttattgactaccaagaaggtagcattgcgc
agcataattgaggaactgctctggtttattaagggtagtaccaacggcaacgacctactg
gctaagaatgtgcgcatttgggagcttaacggtcgtcgtgatttccttgataagaatggt
tttacagatcgtgaagagcatgatttaggtcctatatatggtttccaatggcgtcatttt
ggtgctgagtacttggatatgcacgctgattacactggtaagggtattgatcagcttgct
gagataattaaccgcattaaaacgaacccaaacgaccgtaggctgattgtatgctcttgg
aatgtttcggacctaaagaagatggctttgcctccttgtcattgtttcttccaattttat
gtcagtgacaacaagctttcttgtatgatgcatcagcgttcctgtgaccttggtttgggt
gtacctttcaacattgcttcttatagtatacttactgctatggtggctcaggtttgcggt
ttaggtttaggggagtttgtccataatttggcagacgcccacatttatgttgaccacgtg
gacgccgttactactcagattgctcgcattcctcatccatttccccgtttgcgtttgaac
cctgatattaggaatatcgaggactttactattgacgacattgtagttgaggattacgtc
tcgcatcctcccatacccatggccatgtccgcatga

DBGET integrated database retrieval system