KEGG   Babesia bovis: BBOV_II000780Help
Entry
BBOV_II000780     CDS       T01085                                 

Gene name
18.m06049
Definition
dihydrofolate reductase/thymidilate synthase (EC:2.1.1.45)
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
bbo  Babesia bovis
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bbo00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bbo00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bbo00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2
AA seq 511 aa AA seqDB search
MSNSYEGCGDLTIFVAVALNKVIGHKNQIPWPHITHDFRFLRNGTTYIPPEVLSKNPDIQ
NVVIFGRKTYESIPKASLPLKNRINVILSRTVKEVPGCLVYEDLSTAIRDLRANVPHNKI
FILGGSFLYKEVLDNGLCDKIYLTRLNKEYPGDTYFPDIPDTFEITAISPTFSTDFVSYD
FVIYERKDCKTVFPDPPFDQLLMTGTDISVPKPKYVACPGVRIRNHEEFQYLDILADVLS
HGVLKPNRTGTDAYSKFGYQMRFDLSRSFPLLTTKKVALRSIIEELLWFIKGSTNGNDLL
AKNVRIWELNGRRDFLDKNGFTDREEHDLGPIYGFQWRHFGAEYLDMHADYTGKGIDQLA
EIINRIKTNPNDRRLIVCSWNVSDLKKMALPPCHCFFQFYVSDNKLSCMMHQRSCDLGLG
VPFNIASYSILTAMVAQVCGLGLGEFVHNLADAHIYVDHVDAVTTQIARIPHPFPRLRLN
PDIRNIEDFTIDDIVVEDYVSHPPIPMAMSA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtctaattcatacgaagggtgtggagatcttacgattttcgtagccgttgccttgaat
aaggtaattggccataaaaaccaaattccctggccgcatattacgcatgattttcgtttt
ttgcgtaatggcacaacttacattccacctgaggtgttgtctaagaacccagatatacag
aatgttgtgattttcggtaggaagacttatgaaagtatccctaaagcttcgctccctctt
aaaaaccgtataaacgtgatactgtctcgtactgtcaaggaagttcctggttgtttggtg
tacgaggacctttctactgccattcgtgatttgcgtgcaaatgtccctcataacaagatt
tttatcttaggcggttcttttctttacaaggaggtgcttgacaatggtttgtgtgataag
atttatttgactcgtctcaacaaggagtatcctggtgacacctacttccctgatattccg
gatacttttgagataaccgccattagtcctacgttttccactgactttgtcagttatgat
tttgttatttacgagcgtaaggattgcaagactgttttccccgatcctccttttgatcaa
ttattgatgacagggactgacattagcgttcccaaaccaaagtacgttgcttgtcctggc
gtcaggatacgcaaccatgaagagttccaataccttgacatattggcagatgtgctaagt
catggtgtattgaagcccaaccgtaccggtactgatgcctactctaagtttggctatcag
atgcgatttgacctttcacgttcattcccgttattgactaccaagaaggtagcattgcgc
agcataattgaggaactgctctggtttattaagggtagtaccaacggcaacgacctactg
gctaagaatgtgcgcatttgggagcttaacggtcgtcgtgatttccttgataagaatggt
tttacagatcgtgaagagcatgatttaggtcctatatatggtttccaatggcgtcatttt
ggtgctgagtacttggatatgcacgctgattacactggtaagggtattgatcagcttgct
gagataattaaccgcattaaaacgaacccaaacgaccgtaggctgattgtatgctcttgg
aatgtttcggacctaaagaagatggctttgcctccttgtcattgtttcttccaattttat
gtcagtgacaacaagctttcttgtatgatgcatcagcgttcctgtgaccttggtttgggt
gtacctttcaacattgcttcttatagtatacttactgctatggtggctcaggtttgcggt
ttaggtttaggggagtttgtccataatttggcagacgcccacatttatgttgaccacgtg
gacgccgttactactcagattgctcgcattcctcatccatttccccgtttgcgtttgaac
cctgatattaggaatatcgaggactttactattgacgacattgtagttgaggattacgtc
tcgcatcctcccatacccatggccatgtccgcatga

DBGET integrated database retrieval system