KEGG   Babesia bovis: BBOV_II001120Help
Entry
BBOV_II001120     CDS       T01085                                 

Gene name
18.m06082
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bbo  Babesia bovis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BBOV_II001120 (18.m06082)
Enzymes [BR:bbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BBOV_II001120 (18.m06082)
Exosome [BR:bbo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBOV_II001120 (18.m06082)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 495 aa AA seqDB search
MGLFWAISALALGINIPAGFYNESRFGIGVTYTDAVAIRRNDVQRISQASRSSDSAAFVC
VPSSQWAQPSTGVLDTQRGCATSKVLAKRKEEGNLDSTPEGVEFDSDVDYEDIYDASDYE
SDDVEGEDGSSSEYDSDEDTGNSAFDYNARGELMLPNLTRLSRTRVSKNRHKLFRGRVLH
LADLVYPLVVTDKESSSSIKEVPGLRLLSIPDLVKEVEEARNLGITAFMIHPHIDKSLKS
EFGDEGLNPDGLLPRAIDAVKEAFPDVQVFADATVAHFSLDGHDGLVEPETDVISNDVSV
SQLAKQVTTLASAGCDVVSLNDTLDGSVGVARDALDFEGYTDVSLMSRAGKFNSVYMAQH
QAMLGTTPAQNVRVESYLHDVAIPDEPILKGVQDVDDGADMVAVEPATAFVDVIRSLKDR
LRSPVVAVHTTGEYRALKAAAAAGVYDEKAAAIEALRGLRRAGADLIVSSFAKDVAQWLL
EDMQTNGMENVALGV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgggactgttttgggccattagtgctctggcccttggtatcaatattcccgcaggattc
tacaatgaatcgaggtttggtatcggtgtaacgtatactgatgccgttgctatacgtcga
aacgatgtgcaacgtatttcacaagcctcaagatcgtcagacagcgcggctttcgtttgt
gttccatcgagccaatgggcgcaaccatcaactggtgtgctagacactcaacggggatgt
gctactagcaaggtgctcgccaaacgtaaagaagagggaaatttggattccactcccgag
ggtgtagaatttgattctgatgtggactacgaggacatttatgacgctagtgactatgaa
tctgatgacgtcgagggtgaagacggatcctcttctgagtatgattctgatgaagatacc
ggtaatagtgcgtttgattacaatgcgcgtggagagcttatgcttccaaacctaacccgg
ttatcgagaacgcgagtgtcgaaaaaccggcacaagctattccgcggtcgcgttctccac
ttggctgatttggtatatcctttagtagtcactgacaaggaatcttcatcgtctatcaag
gaggtacctggattgcggctattatcgattcctgaccttgtaaaggaggttgaagaggca
cgtaaccttggaatcacagctttcatgatacacccacacatagacaagtcactaaagagc
gagtttggtgacgagggtttgaaccctgatggacttcttccaagggctatcgatgctgta
aaagaggcgttccccgatgtccaggtgtttgctgatgctacagtggcccacttttcactt
gatggtcatgatggtcttgtggagccggagactgacgtcatttccaatgacgtctctgtt
agccaattagccaagcaggttacaacattggcttccgctggttgtgatgtggtgtcgctc
aacgacacccttgatgggtcggttggtgtcgccagagatgccttggactttgaagggtac
accgacgtatcgctaatgagtcgcgctggaaagttcaactcagtatacatggcacagcat
caggctatgttgggaaccacgccagcgcaaaacgtgcgtgtcgagagctacctccacgac
gtggctattcccgatgaacctatcctcaagggagttcaagacgttgatgacggtgcggat
atggtagccgtggagcccgcgactgcattcgtggacgtcattaggagcctcaaggaccgg
ctgaggtcgccagttgtcgcagtgcacaccaccggtgaatatcgtgccttaaaggcagct
gcagcagccggtgtatatgacgaaaaggccgcggcaatagaggctttacgtggacttcgg
cgtgctggcgcggatctcatagtctcaagcttcgcgaaggacgtggcgcagtggctacta
gaggatatgcagaccaatgggatggaaaatgtagccctgggcgtctga

DBGET integrated database retrieval system