KEGG   Babesia bovis: BBOV_II001220Help
Entry
BBOV_II001220     CDS       T01085                                 

Gene name
18.m06090
Definition
(RefSeq) triosephosphate isomerase protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bbo  Babesia bovis
Pathway
bbo00010  Glycolysis / Gluconeogenesis
bbo00051  Fructose and mannose metabolism
bbo00562  Inositol phosphate metabolism
bbo01100  Metabolic pathways
bbo01110  Biosynthesis of secondary metabolites
bbo01130  Biosynthesis of antibiotics
bbo01200  Carbon metabolism
bbo01230  Biosynthesis of amino acids
Module
bbo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBOV_II001220 (18.m06090)
   00051 Fructose and mannose metabolism
    BBOV_II001220 (18.m06090)
   00562 Inositol phosphate metabolism
    BBOV_II001220 (18.m06090)
Enzymes [BR:bbo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BBOV_II001220 (18.m06090)
Exosome [BR:bbo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BBOV_II001220 (18.m06090)
  Exosomal proteins of bladder cancer cells
   BBOV_II001220 (18.m06090)
  Exosomal proteins of melanoma cells
   BBOV_II001220 (18.m06090)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 5477874
NCBI-ProteinID: XP_001609649
UniProt: A7AT20
Position
2
AA seq 253 aa AA seqDB search
MAAIRKRWVGGNWKCNGSFELVSTLAKAFDAFKFDGNAMDVVLFPSNLYITKALECFDKQ
RFKIGVQNFSQAKCGAFTGEIAIPMLNELGLEWTLIGHSERRTLFGETDAIVAQKVNTAQ
QGKLRAAVCIGENLTERESGRVEAVLTTQLDAFMGMVTDWDIVVIAYEPVWAIGTGKVAT
CEEVREAHQMIRDYMTSKLGSVAETIRIVYGGSVNEQNCQELLHVPNMDGFLVGGKSITP
GFADIMEAAYNVK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggctgctattcgtaagcgctgggtcggtggaaattggaagtgcaatgggtcgtttgag
ttggtgtctacattggccaaagccttcgacgccttcaaattcgatggcaatgctatggat
gtggtattattcccaagcaatttgtacatcaccaaggccctggaatgcttcgacaagcaa
cgcttcaaaattggtgtacagaatttctcccaggctaaatgtggcgccttcaccggtgaa
attgcaattccaatgctcaatgaattaggtcttgaatggactttgattggccattctgag
cgccgcaccctgtttggcgaaactgatgccattgtggcgcagaaggtcaataccgcacag
caaggaaaactacgcgccgctgtatgcatcggtgagaatttaactgagcgtgagtctggt
cgcgtggaggcggtattaaccactcaattggatgcgttcatgggaatggtcactgattgg
gacattgttgtaattgcttacgagcccgtatgggctattggaacaggcaaggttgctacc
tgcgaggaagtacgcgaggctcatcagatgatccgtgactacatgacctcaaagttaggc
tctgtagcggagaccatccgtattgtctacggtggttccgtcaacgaacagaattgccag
gagttgcttcacgtcccaaatatggacggattcctcgtgggaggtaaatccataactccc
ggtttcgcggatatcatggaggccgcttacaacgtaaagtaa

DBGET integrated database retrieval system