KEGG   Babesia bovis: BBOV_II001220Help
Entry
BBOV_II001220     CDS       T01085                                 

Gene name
18.m06090
Definition
triosephosphate isomerase protein (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bbo  Babesia bovis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBOV_II001220 (18.m06090)
   01230 Biosynthesis of amino acids
    BBOV_II001220 (18.m06090)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBOV_II001220 (18.m06090)
   00051 Fructose and mannose metabolism
    BBOV_II001220 (18.m06090)
   00562 Inositol phosphate metabolism
    BBOV_II001220 (18.m06090)
Enzymes [BR:bbo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BBOV_II001220 (18.m06090)
Exosome [BR:bbo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BBOV_II001220 (18.m06090)
  Exosomal proteins of bladder cancer cells
   BBOV_II001220 (18.m06090)
  Exosomal proteins of melanoma cells
   BBOV_II001220 (18.m06090)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 253 aa AA seqDB search
MAAIRKRWVGGNWKCNGSFELVSTLAKAFDAFKFDGNAMDVVLFPSNLYITKALECFDKQ
RFKIGVQNFSQAKCGAFTGEIAIPMLNELGLEWTLIGHSERRTLFGETDAIVAQKVNTAQ
QGKLRAAVCIGENLTERESGRVEAVLTTQLDAFMGMVTDWDIVVIAYEPVWAIGTGKVAT
CEEVREAHQMIRDYMTSKLGSVAETIRIVYGGSVNEQNCQELLHVPNMDGFLVGGKSITP
GFADIMEAAYNVK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggctgctattcgtaagcgctgggtcggtggaaattggaagtgcaatgggtcgtttgag
ttggtgtctacattggccaaagccttcgacgccttcaaattcgatggcaatgctatggat
gtggtattattcccaagcaatttgtacatcaccaaggccctggaatgcttcgacaagcaa
cgcttcaaaattggtgtacagaatttctcccaggctaaatgtggcgccttcaccggtgaa
attgcaattccaatgctcaatgaattaggtcttgaatggactttgattggccattctgag
cgccgcaccctgtttggcgaaactgatgccattgtggcgcagaaggtcaataccgcacag
caaggaaaactacgcgccgctgtatgcatcggtgagaatttaactgagcgtgagtctggt
cgcgtggaggcggtattaaccactcaattggatgcgttcatgggaatggtcactgattgg
gacattgttgtaattgcttacgagcccgtatgggctattggaacaggcaaggttgctacc
tgcgaggaagtacgcgaggctcatcagatgatccgtgactacatgacctcaaagttaggc
tctgtagcggagaccatccgtattgtctacggtggttccgtcaacgaacagaattgccag
gagttgcttcacgtcccaaatatggacggattcctcgtgggaggtaaatccataactccc
ggtttcgcggatatcatggaggccgcttacaacgtaaagtaa

DBGET integrated database retrieval system