KEGG   Babesia bovis: BBOV_II001750Help
Entry
BBOV_II001750     CDS       T01085                                 

Gene name
18.m06135
Definition
histone 2B protein
Orthology
K11252  
histone H2B
Organism
bbo  Babesia bovis
Brite
Exosome [BR:bbo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BBOV_II001750 (18.m06135)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 106 aa AA seqDB search
MVAKKIEKKVKKKVRSETYGTYIFKVLKQVHPDTGISKKSMMIMNSFITDTFDKIASEAS
KLCKYNKKETLSSREVQTAVRLVLPGELSKHAVSEGTKAVTKFTGK
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggtggctaagaagattgaaaagaaagtgaagaagaaggtccgttcggaaacctacggt
acctacatcttcaaggtgcttaagcaagtacacccagacaccggtattagcaagaagtcc
atgatgatcatgaactccttcattaccgacaccttcgacaagattgctagcgaggccagc
aagctttgcaagtacaacaagaaggagactcttagctcccgtgaggtccaaactgctgtc
aggttggttcttccaggagaattgtctaaacacgccgtgtctgagggtaccaaggcagtg
accaagttcactggaaagtaa

DBGET integrated database retrieval system