KEGG   Babesia bovis: BBOV_II003250Help
Entry
BBOV_II003250     CDS       T01085                                 

Gene name
18.m06273
Definition
eukaryotic translation initiation factor 3 subunit
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
bbo  Babesia bovis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    BBOV_II003250 (18.m06273)
Translation factors [BR:bbo03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    BBOV_II003250 (18.m06273)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 732 aa AA seqDB search
MVVIRESDLSAEDLADGLMEWMSDHDDSKDEEEMERLALMEHPIELSTIFPNTIIVTGLP
LVTQEKYDRLMEILRKKLLKDFEKKGYNIGKDMKVDMPYDEDGNTSGVAFLTFANHMEAV
KAQKHINMSKFDASHTLKSALIDDFERIVSDENKCMPALNTFGFTRDDLRTWLFDSDRML
DQFVVRYGDHTEINWFDPLEREPILVYNGERERAQGKRVWTDQKVEWSRNGSYLVFYRRP
GIALYGGPDFELKVRFEHRNVQKVSFSPDEEYLLTWDGTSDSDKSDNSVCIWHVITGEKL
YSFSSREISTMGTDVLRFLWNHNGKYIARLNPSTDGNEILVYQLPEMELIRDAEGKPAPL
KYAAERFDWSPTDDILSVLIPGTLDTPARLVLIDIPSRRELSARNVYNVCQSSMHWHPRG
ECFCLMTTIYRKTGKKGRKNFYQLDLFRLREKYIPVDTIKIEDATVKNLYWEEGGNKRFA
LVVKDEEMSMCSIKFYRVSDEGTARDTVCVATYDLQSQMNKILWSPTGNYFVLGSLSGEG
TLLFCMLSNNDKLEILYKDEHFMMNAMKWSPCGRYLATSVCVPMPSQNLVPSTDTFRYSA
EAGFCIWTFQGRRLYMARRENFYSFEFRPTPPPMLDKAVIEHIKKNLDEYSRRYDIVDEK
AREEYEKQYKAKRQVAEEAFIALAAKLMDYLSKQERFNDFKRGYDEFFDESNWEVSYDIF
EEVLEVKEEILD
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggttgtgataagggagtccgacctttctgctgaggatttggccgatggcctcatggag
tggatgtcggaccatgatgacagcaaagatgaagaggagatggaaagattagcattaatg
gaacatcccattgaattgagtactatatttccaaatactattatcgtcactggtcttcct
ttagttactcaggagaagtacgataggcttatggagattttgagaaagaagttactcaag
gattttgagaagaagggatataatattgggaaggatatgaaggtcgacatgccttatgat
gaggatggtaacactagtggtgtggcatttttaacatttgcaaatcacatggaagctgtg
aaagctcagaagcacattaacatgtccaagtttgatgcatcgcacacgttgaaatcagcg
ctaattgacgattttgagagaatagtcagtgatgagaataagtgtatgccagctctgaat
acttttggatttactagagatgaccttcgtacttggttatttgacagtgaccgtatgtta
gatcaatttgtggttagatacggcgaccacaccgaaattaactggttcgatccgcttgaa
cgtgaacccatattagtttataatggtgagcgcgagcgagcacagggtaagagggtatgg
accgaccaaaaggttgaatggagtcgtaatggttcatatcttgtcttttacaggcgacct
ggtattgctttatatggtggccctgattttgagttaaaggtgcgttttgaacacaggaac
gttcaaaaggtgtcattttcacctgatgaagaatatttgcttacttgggatggtactagt
gattctgacaaatcagataattccgtttgcatatggcatgttataactggtgaaaaacta
tatagtttctcatcacgtgaaatttcaacgatgggtactgacgttttacgtttcttatgg
aaccataacgggaagtatatcgcaaggctcaacccatcgacggacggtaatgagattctc
gtatatcagctacctgagatggagctcatacgagatgccgagggtaagccagcgcctcta
aagtacgctgctgagagatttgattggtctccaacagatgacattctttctgtacttata
ccggggactctagacactccagcgcgtcttgtattgattgatattcccagtcgccgtgag
ttgagtgctagaaacgtttacaatgtttgccaatcatcaatgcattggcatccgaggggt
gaatgcttctgcctcatgactaccatatataggaagacgggtaagaagggacgcaagaac
ttttatcaattagatctattccgactgcgtgaaaagtacattcctgtggacactatcaag
atagaggatgccactgtgaaaaacctgtactgggaagagggtggaaacaaacgtttcgca
ttggttgttaaggacgaggagatgagcatgtgttcgattaaattctaccgtgtatctgat
gaaggcactgctagggatactgtatgcgttgccacttatgaccttcagtcacagatgaat
aagattctgtggtcacctaccggtaactatttcgtcctaggttcactgagcggggaagga
acacttttattttgtatgctcagtaacaatgacaagttggaaatcttgtacaaggacgag
cacttcatgatgaacgcgatgaagtggagcccttgcggtcgttatttggcaacaagcgtt
tgtgttcccatgccatcacagaaccttgtgccgagcactgataccttcagatactcagct
gaagctggtttctgtatatggactttccaaggaaggagattatacatggcacgccgtgaa
aacttttacagctttgagttcaggcctacgcctccacctatgttggataaggccgtgatt
gagcacattaagaaaaatctagatgaatacagtcgtagatacgacattgttgatgagaag
gctcgtgaagaatacgaaaagcagtataaggccaaacgccaagttgccgaagaagcattc
attgcacttgcggctaaactcatggactacctatctaagcaggaacgcttcaacgatttc
aaacgtggttacgacgaatttttcgacgagagtaattgggaggtgtcctatgacatattc
gaggaggttcttgaggtcaaggaggagatccttgattaa

DBGET integrated database retrieval system