KEGG   Babesia bovis: BBOV_II003630Help
Entry
BBOV_II003630     CDS       T01085                                 

Gene name
18.m06304
Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bbo  Babesia bovis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBOV_II003630 (18.m06304)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBOV_II003630 (18.m06304)
   00620 Pyruvate metabolism
    BBOV_II003630 (18.m06304)
   00640 Propanoate metabolism
    BBOV_II003630 (18.m06304)
Enzymes [BR:bbo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BBOV_II003630 (18.m06304)
Lipid biosynthesis proteins [BR:bbo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BBOV_II003630 (18.m06304)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 703 aa AA seqDB search
MSPFSADGPSPRPTDASTAGNNADTTSGSTDELYAEINGTFPFDPSLVDVTYPPIRHEGR
KYHISSLDEYKEMHRRSLEDPEGFWGDMAKKELRWIHPFSRVSEGDFTAADYMWFVGGKI
NACENCVDRWAEERPNDIAIIAEGDDPTKVTTVTYRELRHNVCRFANVLIDKGVRKGDVV
TLYMPSIPELAYAMLACARIGAIHSVVFGGYSAASIAERIRDADSHIIITVDESYRGGKT
IKMKSIVDEALLSCAGVTTCLVLRYAGVKVNMKEGRDFWLDDLLEHVRPYCPIEVMDSED
SLFLLYTSGSTGRPKGVSHTTGGYLVYAHATTKYIFDAHVGDIFGCVADLGWITGHTYVV
YGPLLNGLTTFMFSSLPNYPDPGRYWRMIEQHRITQFYTAPTAIRSLMRHGDDYPRQYDI
SSVRVLGSVGEPINPEAWRWYYEVVGRGRTNVVDTYWQTENGGIVVAPLAGVTPMKPGSA
TLPFFGIDVALVDSATGKEILQNDVGGLLVVRRPWPGIFRTLYNSHKRGIVTYFSKVPGS
YLTGDAAYRDKDGYIWINGRVDDTLNISGHRIGSADIEHALVEVSYVAEAAAVAFPHPIK
GNGIFCFVSLKDGFDIVHDVLERELKLAVRRIVGPFATPDIIISSPNLPKTRSGKIMRRI
LRKLVSGQAKDLGDTSTLADQTVLEGLTVLCHDVLERFNKHIH
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgtctccattctctgctgatggaccatcgcctaggcctacggacgcttcaacggctggt
aacaatgcagacaccactagtggctccactgatgaactatatgccgaaataaatggcaca
ttcccatttgacccatcattggtggatgtaacttacccacccattaggcatgaaggtcgt
aaataccacatatctagtttggatgaatacaaggagatgcaccgccgcagccttgaggac
cctgaaggcttttggggtgacatggccaaaaaggaattgagatggatccatccattttcc
agggtaagtgaaggtgatttcactgcggccgactacatgtggtttgttggcggcaagatc
aacgcttgtgagaattgcgttgaccgttgggctgaggagcgtcctaacgatatagccatt
atagctgagggtgacgatcccactaaggtaactacggtaacatatcgcgagcttcgtcac
aatgtatgtcgatttgccaatgtccttattgataaaggagtgaggaagggtgatgttgtt
actttgtatatgccaagcattcctgagcttgcttacgctatgcttgcgtgtgctcgtatc
ggtgctatacatagtgttgttttcggcggttactcggccgcaagcattgctgaacgtatt
cgtgatgccgactctcatataatcattactgttgacgagagttaccgcggtggcaagact
ataaagatgaagtcgatagttgacgaagcacttttgagttgtgctggagtaaccacatgc
cttgttttacgttacgccggggtcaaggttaatatgaaagagggccgtgacttctggttg
gatgaccttcttgagcatgtgcgtccatactgccctatagaggtaatggacagtgaagac
agtttgtttttattgtacacttctggatctaccgggcggccgaagggtgtatcccatacc
actgggggatacctagtatatgcccatgcaactacgaaatatatatttgatgcccatgtt
ggcgatatattcggctgtgttgctgatttaggttggattactggacacacttatgtagtg
tacggccctttgctcaatgggctcacgacgttcatgttttcatcattacctaactacccc
gaccccgggcgatactggcgtatgattgagcagcatcgtataactcagttttacactgca
ccaactgccattcgaagcctcatgaggcatggtgacgactaccctcgtcaatatgatata
agctcagtcagggtcctaggttcagttggtgagcctattaaccctgaggcctggcgttgg
tactacgaagtagtaggccgcggtcgcaccaatgtggtggacacttactggcagactgaa
aatggcggtatagtggtagcgccattggctggtgtgactcccatgaaacccgggtcggcc
actttacccttctttggcattgacgtcgcgttggtcgactctgccactggcaaggaaatt
ttacagaacgacgttggtggcctactagttgtccgtcgtccatggccaggtatattcagg
actttgtacaatagccacaagcgtggcattgttacgtactttagcaaagttcctggcagt
tacctcacgggtgacgctgcctacagggacaaggatggatatatctggattaacggacgt
gttgatgatacccttaacatatcggggcaccgtatagggtcggccgatattgagcacgcc
cttgtggaggtgtcctatgtagcagaggctgctgccgtagcattcccgcatcccatcaag
ggtaacggtatcttctgctttgtgtccctaaaggacggttttgacatagttcacgacgtt
ttggagcgtgagcttaaattggcagttcgccgtatagtcgggcctttcgccactccagac
atcatcatatcgagtccgaacttgcccaagacacgtagtggcaagataatgcgccgcata
ttgcgcaagcttgtcagtgggcaggccaaggatcttggcgacacctcgactctggctgac
cagactgtcctcgagggtttgacagtcctgtgccatgatgtcctggaacgcttcaacaag
catatacattaa

DBGET integrated database retrieval system