KEGG   Babesia bovis: BBOV_II003630Help
Entry
BBOV_II003630     CDS       T01085                                 

Gene name
18.m06304
Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bbo  Babesia bovis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bbo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bbo00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bbo00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bbo00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 703 aa AA seqDB search
MSPFSADGPSPRPTDASTAGNNADTTSGSTDELYAEINGTFPFDPSLVDVTYPPIRHEGR
KYHISSLDEYKEMHRRSLEDPEGFWGDMAKKELRWIHPFSRVSEGDFTAADYMWFVGGKI
NACENCVDRWAEERPNDIAIIAEGDDPTKVTTVTYRELRHNVCRFANVLIDKGVRKGDVV
TLYMPSIPELAYAMLACARIGAIHSVVFGGYSAASIAERIRDADSHIIITVDESYRGGKT
IKMKSIVDEALLSCAGVTTCLVLRYAGVKVNMKEGRDFWLDDLLEHVRPYCPIEVMDSED
SLFLLYTSGSTGRPKGVSHTTGGYLVYAHATTKYIFDAHVGDIFGCVADLGWITGHTYVV
YGPLLNGLTTFMFSSLPNYPDPGRYWRMIEQHRITQFYTAPTAIRSLMRHGDDYPRQYDI
SSVRVLGSVGEPINPEAWRWYYEVVGRGRTNVVDTYWQTENGGIVVAPLAGVTPMKPGSA
TLPFFGIDVALVDSATGKEILQNDVGGLLVVRRPWPGIFRTLYNSHKRGIVTYFSKVPGS
YLTGDAAYRDKDGYIWINGRVDDTLNISGHRIGSADIEHALVEVSYVAEAAAVAFPHPIK
GNGIFCFVSLKDGFDIVHDVLERELKLAVRRIVGPFATPDIIISSPNLPKTRSGKIMRRI
LRKLVSGQAKDLGDTSTLADQTVLEGLTVLCHDVLERFNKHIH
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgtctccattctctgctgatggaccatcgcctaggcctacggacgcttcaacggctggt
aacaatgcagacaccactagtggctccactgatgaactatatgccgaaataaatggcaca
ttcccatttgacccatcattggtggatgtaacttacccacccattaggcatgaaggtcgt
aaataccacatatctagtttggatgaatacaaggagatgcaccgccgcagccttgaggac
cctgaaggcttttggggtgacatggccaaaaaggaattgagatggatccatccattttcc
agggtaagtgaaggtgatttcactgcggccgactacatgtggtttgttggcggcaagatc
aacgcttgtgagaattgcgttgaccgttgggctgaggagcgtcctaacgatatagccatt
atagctgagggtgacgatcccactaaggtaactacggtaacatatcgcgagcttcgtcac
aatgtatgtcgatttgccaatgtccttattgataaaggagtgaggaagggtgatgttgtt
actttgtatatgccaagcattcctgagcttgcttacgctatgcttgcgtgtgctcgtatc
ggtgctatacatagtgttgttttcggcggttactcggccgcaagcattgctgaacgtatt
cgtgatgccgactctcatataatcattactgttgacgagagttaccgcggtggcaagact
ataaagatgaagtcgatagttgacgaagcacttttgagttgtgctggagtaaccacatgc
cttgttttacgttacgccggggtcaaggttaatatgaaagagggccgtgacttctggttg
gatgaccttcttgagcatgtgcgtccatactgccctatagaggtaatggacagtgaagac
agtttgtttttattgtacacttctggatctaccgggcggccgaagggtgtatcccatacc
actgggggatacctagtatatgcccatgcaactacgaaatatatatttgatgcccatgtt
ggcgatatattcggctgtgttgctgatttaggttggattactggacacacttatgtagtg
tacggccctttgctcaatgggctcacgacgttcatgttttcatcattacctaactacccc
gaccccgggcgatactggcgtatgattgagcagcatcgtataactcagttttacactgca
ccaactgccattcgaagcctcatgaggcatggtgacgactaccctcgtcaatatgatata
agctcagtcagggtcctaggttcagttggtgagcctattaaccctgaggcctggcgttgg
tactacgaagtagtaggccgcggtcgcaccaatgtggtggacacttactggcagactgaa
aatggcggtatagtggtagcgccattggctggtgtgactcccatgaaacccgggtcggcc
actttacccttctttggcattgacgtcgcgttggtcgactctgccactggcaaggaaatt
ttacagaacgacgttggtggcctactagttgtccgtcgtccatggccaggtatattcagg
actttgtacaatagccacaagcgtggcattgttacgtactttagcaaagttcctggcagt
tacctcacgggtgacgctgcctacagggacaaggatggatatatctggattaacggacgt
gttgatgatacccttaacatatcggggcaccgtatagggtcggccgatattgagcacgcc
cttgtggaggtgtcctatgtagcagaggctgctgccgtagcattcccgcatcccatcaag
ggtaacggtatcttctgctttgtgtccctaaaggacggttttgacatagttcacgacgtt
ttggagcgtgagcttaaattggcagttcgccgtatagtcgggcctttcgccactccagac
atcatcatatcgagtccgaacttgcccaagacacgtagtggcaagataatgcgccgcata
ttgcgcaagcttgtcagtgggcaggccaaggatcttggcgacacctcgactctggctgac
cagactgtcctcgagggtttgacagtcctgtgccatgatgtcctggaacgcttcaacaag
catatacattaa

DBGET integrated database retrieval system