KEGG   Babesia bovis: BBOV_II005800Help
Entry
BBOV_II005800     CDS       T01085                                 

Gene name
18.m06482
Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
bbo  Babesia bovis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BBOV_II005800 (18.m06482)
Enzymes [BR:bbo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     BBOV_II005800 (18.m06482)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 298 aa AA seqDB search
MEINTDYENVINLYLQGERFFKEKPNSVDTSIELKVTLIKRIPISPTVYIFIFQYPPELE
QHFMLHIFAHFEFKGERMLPKVQGQWNGKICQQNDTNQVSRKYTPIYIDQEKKEVHILMR
IYRPCEKYPDGGSLTRVIECLIPQDQLTIYPSMFKFSLTQNGALTIGGDKVVEFNHLNLV
AGGTGITPYVRYLINNKKIPVNLVYCNKTLKEILLKPLLDKLQERGLLKVKYLVTSEDPE
VIRNYKPNNDALVFGKLSIEHCEGFLETKDSFTIACGPPGMVMKAKEITTQLGLPMAC
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggagattaatacagattatgaaaatgtaatcaatttgtacctccaaggagaacgtttc
tttaaagaaaaaccaaacagcgtagacaccagtatagaattgaaagttacacttatcaag
agaataccaatatcacctacagtctacattttcatattccaatatccaccggagttagaa
caacattttatgttacatattttcgcgcattttgaattcaaaggagaacgcatgttacca
aaggtccagggtcagtggaatggaaagatatgtcaacagaatgacactaatcaagtgtcc
cgtaaatacacacctatatatatcgatcaagaaaaaaaggaagtacacatactaatgaga
atataccgtccgtgtgagaaatatcccgatggaggcagcctgaccagagttattgagtgt
ttgataccacaggaccaattgacaatttatccatccatgtttaaatttagcttaactcaa
aatggagctttaacaattggaggagataaagtcgtcgagtttaaccacctaaacctcgtt
gcaggaggaactggaataacgccatatgtgcgttatctaatcaacaacaagaagatacca
gtgaatttagtgtactgcaataaaacattaaaggagattctgcttaaaccgttactcgat
aagcttcaagaacgtggattattaaaggttaagtacctagtgacttcggaagacccagag
gtaatacgaaactataaaccaaataacgacgctttggtctttgggaagttgtccattgag
cactgtgaaggtttccttgaaactaaggactccttcaccattgcttgtggtccacctggt
atggtgatgaaagcaaaggaaatcacaacacaactagggctaccaatggcttgttga

DBGET integrated database retrieval system