KEGG   Babesia bovis: BBOV_II006160Help
Entry
BBOV_II006160     CDS       T01085                                 

Gene name
18.m06509
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bbo  Babesia bovis
Pathway
bbo00230  Purine metabolism
bbo01100  Metabolic pathways
Module
bbo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BBOV_II006160 (18.m06509)
Enzymes [BR:bbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BBOV_II006160 (18.m06509)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_22 AAA_33 AAA_18 AAA ABC_tran AAA_16 RsgA_GTPase MMR_HSR1 dNK RNA_helicase NB-ARC AAA_24 Roc AAA_14 ATPase_2 MobB AAA_23 NTPase_1 AAA_28 AAA_5 WEMBL SRPRB cobW NACHT AAA_21 AAA_29
Motif
Other DBs
NCBI-GeneID: 5478368
NCBI-ProteinID: XP_001610134
UniProt: A7AUF5
Position
2
AA seq 194 aa AA seqDB search
MAQVPFLVIVGPSGVGKTTLYKMLLEEFQGFFELSVSCTTRKIRPHEIDGVNYYFITEEK
FNQMKDEEAFLECATYVGNQYGTPCSEITRIQSKGKVPLLEIEVCGFQKIKSLGIPLYSV
FVSTSDIDALRKRLVRRGSDEEQTVDKRIGRAVEEIAEAKHAGFSMILYNDVLEVAYKQL
REQIIKWYGLKSEQ
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggtccccttcttagttatagtcggcccatcgggtgttggtaaaaccaccctg
tacaagatgcttcttgaggaattccaaggattcttcgaacttagcgttagctgtactacc
agaaagatcagaccacatgaaatagacggagttaactattatttcatcacagaagaaaaa
ttcaatcagatgaaagatgaagaagccttcctagaatgcgccacctacgtaggcaaccaa
tatggaactccctgctccgaaataacgcgcatccaatcaaaaggcaaagtacctttgttg
gaaatagaagtttgtggtttccaaaaaatcaaatcgttgggaataccactatacagcgta
tttgtaagcacaagtgatatagatgctctcagaaagagacttgtaagaagaggatccgat
gaagaacaaaccgtagataaaagaattggaagagcagttgaagaaatagcggaagcaaag
cacgctggattcagtatgatattgtacaatgatgtactagaagttgcatacaagcaactt
agggaacaaataataaaatggtatggactcaaaagtgagcaatga

DBGET integrated database retrieval system