KEGG   Babesia bovis: BBOV_II006160Help
Entry
BBOV_II006160     CDS       T01085                                 

Gene name
18.m06509
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bbo  Babesia bovis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bbo00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 194 aa AA seqDB search
MAQVPFLVIVGPSGVGKTTLYKMLLEEFQGFFELSVSCTTRKIRPHEIDGVNYYFITEEK
FNQMKDEEAFLECATYVGNQYGTPCSEITRIQSKGKVPLLEIEVCGFQKIKSLGIPLYSV
FVSTSDIDALRKRLVRRGSDEEQTVDKRIGRAVEEIAEAKHAGFSMILYNDVLEVAYKQL
REQIIKWYGLKSEQ
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggtccccttcttagttatagtcggcccatcgggtgttggtaaaaccaccctg
tacaagatgcttcttgaggaattccaaggattcttcgaacttagcgttagctgtactacc
agaaagatcagaccacatgaaatagacggagttaactattatttcatcacagaagaaaaa
ttcaatcagatgaaagatgaagaagccttcctagaatgcgccacctacgtaggcaaccaa
tatggaactccctgctccgaaataacgcgcatccaatcaaaaggcaaagtacctttgttg
gaaatagaagtttgtggtttccaaaaaatcaaatcgttgggaataccactatacagcgta
tttgtaagcacaagtgatatagatgctctcagaaagagacttgtaagaagaggatccgat
gaagaacaaaccgtagataaaagaattggaagagcagttgaagaaatagcggaagcaaag
cacgctggattcagtatgatattgtacaatgatgtactagaagttgcatacaagcaactt
agggaacaaataataaaatggtatggactcaaaagtgagcaatga

DBGET integrated database retrieval system