KEGG   Babesia bovis: BBOV_II006170Help
Entry
BBOV_II006170     CDS       T01085                                 

Gene name
18.m06510
Definition
6-phosphofructokinase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bbo  Babesia bovis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBOV_II006170 (18.m06510)
   01230 Biosynthesis of amino acids
    BBOV_II006170 (18.m06510)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBOV_II006170 (18.m06510)
   00030 Pentose phosphate pathway
    BBOV_II006170 (18.m06510)
   00051 Fructose and mannose metabolism
    BBOV_II006170 (18.m06510)
   00052 Galactose metabolism
    BBOV_II006170 (18.m06510)
Enzymes [BR:bbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BBOV_II006170 (18.m06510)
Protein phosphatases and associated proteins [BR:bbo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BBOV_II006170 (18.m06510)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1337 aa AA seqDB search
MMEEKVGRGSGEDGDMRMVRMVSAESICGDKSCQSPASSVELDMRDFVDDDFERRRKRYQ
LNKSFNTFRRCATRQPDHDSFTSLPGIKHNTAEFSYPINPFVNKKDGDRIKRVNSCYISK
SVCQGLYRNRDVELPTLLQYDFHLLDEHDESGEELRDFDELSSVLSHIAHNKMVSVAPQM
LATSVTSHPIIKIGMVLSGGPAPGGHNVIAGVFDYLYLRNTQSQLIGFHGGLDGLFGRHH
EVVTPEVMDNFRNMGGFNMFLSGRGRINGPEDLDRVVEAVNDLDLDGLIIVGGDGSNSNA
ALLANHMAYRFGCDSSDGRPVLRKRCCVIGIPKTVDGDVQSHNIEVSFGFDTAARTYSEL
IGNLCTDASSTQYTYHFIRVMGRSASHLALECGMQTHPNIVLIGEEAQSKQQSLSMIVDY
IVDLMEKRYQMGKPYGVVLIPEGLIEFIPEINVLISELNEILVQAKGPITHLDPSCLTKS
RATWEILPDTIREQLLMDREATGYVMLAKIATERLLLMLVEARIAERKLSHLSSLRFMTH
YFGYEGRCAMPSDFDGAYCYSLGYNAGVLISAKRNGYMSVIRDLKAPISEWIPLGVPFLH
LMHMINLGGKRAPAIRKTLLNLDGKLFKTFEKVREIWAYNDLYRSPGPIQLFNSDYQRCF
SISDPQVEDLIGSFKEAPAEKSRFLLHRNLECMSPLQLSRLEWRPPIPMLCHDPRARMRN
FKEVHSNDSYTRDQVALNYPYMTRRSHFSLHEVVGHYSGDRTNLNKATQGLRVGVVLLSK
QAPGVLNVIWGIHERMSIIGGSCVAFHGALGLIEGNYIELTSSDFDTFRNQGGLDMIHRS
RVQYFQEPKNWSLALETCTQLGLNALIILGDEFAMTQGALLTEYFLSQQSSICVIGVPVA
GSNSLAGPLIESCVGFDSNAQLYASLVGNVLTDAVSMPKYWHFVKILGRYPSLEVLECAL
QTHPNVIIIAEEYGSADKTLFDVVRDIADAVCKRAAMGKNYGTVLIPDHLILHLPNTKSM
LMELRSVLMEASAANKRREAVDSFLNYDKSEPQSSEWINKMTPWSLGVFGSLPLYIRKEV
LNFDMEVALERLDIEIMLSKMVKEELNLRKATGAYKGNYAAVTHYFGYQGRCCTPSEFDC
SLAFAYGHVASIAAESGLTGVCCSIRGLCGEIEAWKMYAVPLTCLMKVEPNIMTPISLND
FKKGELPMVPSSTVSLKSKAFRKLSMARKKWLVEDLFINPGPIQFDGIVTAQSMVLITEH
AEYYQMLHSVERFLNVLQNTCKFGVSEEYLNHAFVQLWGLLKVSQSPGDLVRIAEMLKAE
EDNSLRSTGNAFSLSSF
NT seq 4014 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagagaaggttggccgtggttctggtgaggatggagatatgcgtatggtaagg
atggtaagtgcggaatcgatttgcggagacaaatcttgtcaatctcctgcatctagtgtt
gagttggacatgagggactttgttgacgatgactttgagagacgtcgtaagcgttaccag
ttgaacaaaagtttcaacacatttcgtcgatgtgcaactcgtcagcctgatcacgatagt
tttacttctttgcctggtatcaagcacaacactgctgagttttcttacccaataaatcca
tttgttaataagaaagatggtgaccgtataaagcgtgtaaactcatgttacatatccaag
agtgtttgtcagggtctttaccgtaaccgtgacgttgagttgcctacgctgttacagtat
gatttccacttattggacgagcacgatgaaagtggtgaggagttgcgtgattttgatgag
ttatcatctgtattgagtcacattgctcacaacaagatggtttcagttgctcctcagatg
ttggctacttctgttacatctcaccctatcataaagattggtatggttttgagtggtggt
cccgctcctggtggtcacaatgtaattgctggtgtttttgactatctttatttacgtaat
actcaatcgcagttaataggttttcatggtggccttgatggtttatttggtcgtcatcat
gaagttgtgactcctgaagttatggacaatttccgcaacatgggtggttttaacatgttt
ttgagtggtcgtggtaggattaacggtcctgaggatctggaccgtgttgttgaggcagtg
aacgatttggatttggacggtttgattattgttggtggtgatggttctaacagcaatgct
gctttattggcaaaccatatggcttatcgttttggttgtgacagttctgacgggcgtcct
gtgttgcgtaagcgttgctgtgtgattggtattccgaagactgtggatggtgacgtccaa
tctcataatattgaggtcagctttggttttgacactgctgctcgtacatattctgagttg
attggtaatttatgtaccgatgccagtagcactcagtacacttatcactttattcgtgtt
atgggtcgttcggcatcccatttggctttggagtgtggtatgcagacccaccctaatatt
gtattgattggtgaagaggcccagagtaagcagcagtctttatctatgattgtggattac
attgttgatcttatggagaagcgttaccagatgggcaagccgtatggtgtggtattgatt
cctgagggtttgattgaattcattcccgagattaacgttttgatatctgaattgaatgag
attctagtccaggctaaagggcctataactcaccttgatccatcatgtttgacgaaaagt
cgtgccacgtgggagatccttcctgacaccattcgtgagcagttactgatggaccgtgag
gccactggttacgtgatgttggccaaaattgccactgagcgtcttttattaatgttggtt
gaggctcgcattgctgagcgcaagttgagtcatttgagttcattacgtttcatgactcat
tacttcggttacgagggtaggtgtgccatgccatctgactttgatggtgcctactgttac
tcattgggttacaacgctggtgttttgatcagtgctaagcgtaacggttacatgtctgta
attcgtgatttgaaggctccaatttcggaatggatccccttgggtgttccatttttgcat
ttgatgcatatgatcaacttagggggcaagcgtgctcctgcaattcgcaagacactgttg
aacctcgatggcaagctattcaagacctttgagaaggtacgtgaaatctgggcttacaac
gacttgtatcgctctccgggtcccatacagctatttaacagtgactatcagcgttgcttc
agtatttccgatccccaggttgaggatttgattggttcgtttaaggaagctcctgctgag
aaatctcgattcctattacatcgtaatttggaatgcatgagtcccttacagctcagtcgt
cttgagtggcgtccacctattcctatgctttgtcacgaccctcgtgctcgtatgaggaac
ttcaaggaggtccatagcaacgattcgtacactcgcgaccaggttgcattgaattacccg
tatatgactcgtagaagccactttagcttacatgaggtcgttggtcactattctggtgac
cgaactaatcttaacaaggcaacacagggtcttcgtgttggtgttgtgctgttgtccaag
caggctccgggtgttttgaatgtgatttggggtattcacgagcgcatgtcgattattggt
ggcagttgtgttgcttttcacggagctctaggtctgattgagggtaactacattgagttg
acttcaagtgactttgacactttccgtaaccagggtggtttggatatgattcatcgttct
cgtgtgcagtatttccaggaacctaagaactggtctcttgcattggagacatgcactcaa
ttgggattgaacgctttgattatattaggtgacgagtttgccatgactcagggtgcttta
ttaactgaatacttcttgagtcagcagagttcgatttgtgtcattggtgtgcctgttgct
ggttctaacagtcttgcaggtcccttgattgagagttgtgttggttttgattctaacgct
cagttatacgcttcattggttggcaatgtactgactgatgctgttagcatgccgaaatat
tggcattttgtaaagattttgggtcgttatcccagtttggaggtgcttgagtgtgctctt
cagactcatcccaatgtgataatcattgctgaggagtatggttctgctgacaagactttg
tttgatgttgttcgtgacattgctgatgctgtttgcaagcgtgctgctatgggtaagaac
tatggtacggtattgattcctgaccacttgattcttcaccttcccaataccaagtctatg
ttaatggagctgcgttctgttttgatggaggccagtgctgctaataagcgtcgggaggct
gttgacagtttcctgaattatgataagtctgagccacaatctagtgaatggataaacaag
atgactccttggagtttgggtgttttcggttcgttaccattgtatattcgtaaggaggtg
ttgaactttgacatggaggttgcattggagcgtttggacattgagattatgttgtctaag
atggtaaaggaggagttgaatttgcgcaaggctacgggtgcttacaagggcaactatgct
gctgtaactcattatttcggttaccagggtcgttgctgtacaccatcagaatttgattgc
agtctagcttttgcttatggtcacgtcgcttccatagctgcggagagtggtttgactggt
gtttgctgttcgattcgtggtttatgcggtgagattgaggcatggaagatgtatgctgtt
ccattgacttgcttgatgaaggttgaacccaatataatgactcctatatctttgaacgac
tttaagaagggtgaattgcctatggttcctagttccactgtaagcctaaagagtaaggct
tttaggaaactatctatggctcgtaagaaatggttggttgaggatctgtttattaatccc
ggtcctattcaatttgatggcattgtaactgctcagagcatggttttgattactgagcat
gctgagtactatcagatgcttcacagtgttgagcgtttcttgaatgttcttcagaatacg
tgcaagtttggtgttagtgaggagtatttgaaccatgcattcgttcagctttggggtctt
ttgaaggtatctcaatctcctggcgacttggtacgtattgctgagatgctcaaggcagag
gaggacaacagccttcgttccacaggaaatgctttttcgttgagttcgttttaa

DBGET integrated database retrieval system