KEGG   Babesia bovis: BBOV_II007070Help
Entry
BBOV_II007070     CDS       T01085                                 

Gene name
18.m06585
Definition
hypothetical protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bbo  Babesia bovis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bbo00900]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 353 aa AA seqDB search
MSVPSAFHRQHRNIVIEEDEPIHLLDDLSHGDGTFWDHRGVAFAKVNLSLDIDPSSRVSD
SLLSIHSVMHKILWGDHISIKLLRDVDADLLSKHYDTTPQGDVLLLLDETSDIDKHASNR
SSETDVSFPFDESNLIAKTLDKARRGNESYLVLTRKRIPAGTGLGGGTADGAYVLKSLGS
MLPPEESLSIGSDFAFLQSSDSIALVSGRGDKVTPLPPLNYTMPLYILIPDEVCNTAEIF
KRARELMQQGRMEYRTYSMERAIIELAQFDKYRPHNSLESCIDNEVVKSLLSTLADNLGQ
HQYGMSGSGSACFAIGVDDIDVLRVREVFGRPLKIVKTRLMQPGDTRCEFSYL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgccctcagccttccaccgccaacatcgcaatatagtaatagaagaagatgag
cctattcatcttttggatgatttatcgcatggggatggtacattctgggaccatcggggc
gtagcctttgctaaggttaacctttcgttggatatcgacccttcatctcgtgtatcggac
tcgctgttgagcattcacagcgtgatgcacaagattctttggggagatcacatatcgata
aagctgttacgcgatgtggacgctgacctgctgtctaagcactatgacactactcctcag
ggtgatgtactgttacttttggacgaaacatcggacatagataaacacgcgtcgaatcgt
tctagcgagaccgatgtatcattcccctttgacgagtccaacctcattgccaagactttg
gacaaagctcgcaggggcaacgagtcatatttagtgttgactcgaaaacgcatacctgct
ggcactggacttggtggcggtactgctgacggggcatatgttctaaagtcacttggtagc
atgctacctcctgaagagagcctttcaattggttctgactttgcatttctacagtctagt
gacagcatagctctagtatctggtaggggcgacaaagtaacgcctctaccaccgttgaat
tacacgatgccgctatacatcttaatacctgacgaggtatgtaatacggctgaaatattc
aagcgtgctcgtgagttgatgcagcaggggcgtatggaatatcgaacgtattcaatggag
agggccattatagaactggcgcaattcgacaagtacaggcctcataacagcctggagtca
tgtatagataatgaagttgtgaagtccctgctgtcaacactagcagacaacctgggtcaa
catcagtacggcatgagcggcagcggcagcgcctgctttgccataggagtggatgacatt
gatgtattacgtgttagggaggtattcggccgccctctgaagattgtaaaaaccaggtta
atgcaacctggagacactcgctgtgaattcagttacttataa

DBGET integrated database retrieval system