KEGG   Babesia bovis: BBOV_II007070Help
Entry
BBOV_II007070     CDS       T01085                                 

Gene name
18.m06585
Definition
hypothetical protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bbo  Babesia bovis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BBOV_II007070 (18.m06585)
Enzymes [BR:bbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BBOV_II007070 (18.m06585)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 353 aa AA seqDB search
MSVPSAFHRQHRNIVIEEDEPIHLLDDLSHGDGTFWDHRGVAFAKVNLSLDIDPSSRVSD
SLLSIHSVMHKILWGDHISIKLLRDVDADLLSKHYDTTPQGDVLLLLDETSDIDKHASNR
SSETDVSFPFDESNLIAKTLDKARRGNESYLVLTRKRIPAGTGLGGGTADGAYVLKSLGS
MLPPEESLSIGSDFAFLQSSDSIALVSGRGDKVTPLPPLNYTMPLYILIPDEVCNTAEIF
KRARELMQQGRMEYRTYSMERAIIELAQFDKYRPHNSLESCIDNEVVKSLLSTLADNLGQ
HQYGMSGSGSACFAIGVDDIDVLRVREVFGRPLKIVKTRLMQPGDTRCEFSYL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgccctcagccttccaccgccaacatcgcaatatagtaatagaagaagatgag
cctattcatcttttggatgatttatcgcatggggatggtacattctgggaccatcggggc
gtagcctttgctaaggttaacctttcgttggatatcgacccttcatctcgtgtatcggac
tcgctgttgagcattcacagcgtgatgcacaagattctttggggagatcacatatcgata
aagctgttacgcgatgtggacgctgacctgctgtctaagcactatgacactactcctcag
ggtgatgtactgttacttttggacgaaacatcggacatagataaacacgcgtcgaatcgt
tctagcgagaccgatgtatcattcccctttgacgagtccaacctcattgccaagactttg
gacaaagctcgcaggggcaacgagtcatatttagtgttgactcgaaaacgcatacctgct
ggcactggacttggtggcggtactgctgacggggcatatgttctaaagtcacttggtagc
atgctacctcctgaagagagcctttcaattggttctgactttgcatttctacagtctagt
gacagcatagctctagtatctggtaggggcgacaaagtaacgcctctaccaccgttgaat
tacacgatgccgctatacatcttaatacctgacgaggtatgtaatacggctgaaatattc
aagcgtgctcgtgagttgatgcagcaggggcgtatggaatatcgaacgtattcaatggag
agggccattatagaactggcgcaattcgacaagtacaggcctcataacagcctggagtca
tgtatagataatgaagttgtgaagtccctgctgtcaacactagcagacaacctgggtcaa
catcagtacggcatgagcggcagcggcagcgcctgctttgccataggagtggatgacatt
gatgtattacgtgttagggaggtattcggccgccctctgaagattgtaaaaaccaggtta
atgcaacctggagacactcgctgtgaattcagttacttataa

DBGET integrated database retrieval system